DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckn and Samd5

DIOPT Version :9

Sequence 1:NP_611009.1 Gene:ckn / 36673 FlyBaseID:FBgn0033987 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001102371.1 Gene:Samd5 / 365038 RGDID:1311012 Length:173 Species:Rattus norvegicus


Alignment Length:62 Identity:21/62 - (33%)
Similarity:36/62 - (58%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 LIIDWLLEMKHEEYAQLFIAAGY-DLPTIARMTPEDLTAIGIKNPHHRERIKQRIDKLQVLD 319
            ::.:||..::..:||:.|:..|| ||....::...||.|||:..|.||.||.:.:.:|:..|
  Rat     5 IVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVHRLREQD 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cknNP_611009.1 SAM_caskin1,2_repeat1 254..319 CDD:188896 20/60 (33%)
SAM 260..316 CDD:197735 19/56 (34%)
SAM_caskin1,2_repeat2 320..390 CDD:188897 21/62 (34%)
SAM 326..387 CDD:197735
Caskin-tail <887..912 CDD:293238
Samd5NP_001102371.1 SAM_Samd5 2..64 CDD:188926 20/58 (34%)
SAM 6..65 CDD:197735 20/58 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.