DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckn and Samd5

DIOPT Version :10

Sequence 1:NP_611009.1 Gene:ckn / 36673 FlyBaseID:FBgn0033987 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_017169459.1 Gene:Samd5 / 320825 MGIID:2444815 Length:182 Species:Mus musculus


Alignment Length:102 Identity:27/102 - (26%)
Similarity:48/102 - (47%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 IEEWLQLLRLEEYIQPLLEQNYKTVRDVTQVTWEDLEDIGIVKLGHQKKILLAIKRVKDIISGKW 393
            :.|||:.|:|.:|.:..::..|..:....|:...||:.||::...|:::||.|:.|:::     .
Mouse     6 VYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVHRLRE-----Q 65

  Fly   394 NPGGANAYQQQEYQRKPWQFNVPIPSTP--SYVPTTR 428
            :...|..|...|.|        |:|..|  ..||..|
Mouse    66 DAAAAGLYFTLEPQ--------PVPPAPLVEAVPPGR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cknNP_611009.1 SAM_caskin1,2_repeat1 254..319 CDD:188896
SAM_caskin1,2_repeat2 320..390 CDD:188897 17/60 (28%)
Caskin-tail <887..912 CDD:465209
Samd5XP_017169459.1 SAM_Samd5 2..64 CDD:188926 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.