DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckn and Sash3

DIOPT Version :9

Sequence 1:NP_611009.1 Gene:ckn / 36673 FlyBaseID:FBgn0033987 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_006257592.1 Gene:Sash3 / 317578 RGDID:1560293 Length:381 Species:Rattus norvegicus


Alignment Length:435 Identity:87/435 - (20%)
Similarity:144/435 - (33%) Gaps:126/435 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SGPLRHHQNHQADDGISMSGSSIVSSPSLEEGGFNLPRETSVAL--------------RLKDEVG 114
            |.|:...:....||.|....|.:::.....:.|..|.::....:              .|.:|:|
  Rat    37 SSPVVSEKEFNLDDNIPEDDSGVLTPEDSGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMG 101

  Fly   115 GT---STAAPTTGGPGGGGATVVGAPPPGAGKPGVAMVPPPPVFCATLREPLTHKAAVYYHQQLA 176
            .|   .:|:||:..        .....||..|..:|...|..      ||.|.          |:
  Rat   102 DTLEEGSASPTSPD--------CSLDSPGPEKMALAFSEPEE------RELLA----------LS 142

  Fly   177 LQEDQGIDLTQSPGRDSPGSSSGSAGSGSRHSTASLDSGRASSYLTGVSSSGASIRAPLSSPRCS 241
            .|...|.:|.      |||..|||          .::...|..| ||.....|.:....:.    
  Rat   143 RQTSTGSELC------SPGPGSGS----------FIEESPAPQY-TGPFCGRARVHTDFTP---- 186

  Fly   242 SVSSCSIGSVDRQRNDEL-IID------W--LLEMKHEEYAQLFIAAGYDLPTIARMTPEDLTAI 297
              |.....|:..|:.|.: ||:      |  ||..|...:..:::          .:.||:  |:
  Rat   187 --SPYDHDSLKLQKGDVIQIIEKPPVGTWLGLLNGKLGSFKFIYV----------DVLPEE--AV 237

  Fly   298 GIKNPHHRERIKQRIDKLQVLDNLPHFVPGSIEEWLQLLRLEEYIQPLLEQNYKTVRDVTQVTWE 362
            |...|..|:...:|          |.  |.::.|.|:.:.|||:...||...|:|:.|..::...
  Rat   238 GPVRPSRRQSKSKR----------PK--PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRET 290

  Fly   363 DLEDIGIVKLGHQKKILLAIKRVKDIISGKWNPGGANAYQQQEYQRKPWQFNVPIPSTPSYVPTT 427
            .|.::.|:...|:.|:|.|.:.:.|..:.    |...|.:..|..::|....|..|..       
  Rat   291 HLNELNIMDPQHRAKLLTAAELLLDYDTA----GSEEAEEGAESSQEPALHTVSEPKV------- 344

  Fly   428 RVSWDDTKIYATSSVLNSTAPSGSSCLNSSLANGDAYYCTGSNHE 472
                              ..|..|.|...|.:..|....||:..:
  Rat   345 ------------------DIPRDSGCFEGSESGRDEAELTGTEEQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cknNP_611009.1 SAM_caskin1,2_repeat1 254..319 CDD:188896 15/73 (21%)
SAM 260..316 CDD:197735 13/63 (21%)
SAM_caskin1,2_repeat2 320..390 CDD:188897 19/69 (28%)
SAM 326..387 CDD:197735 17/60 (28%)
Caskin-tail <887..912 CDD:293238
Sash3XP_006257592.1 SLY 21..174 CDD:289268 37/177 (21%)
SH3_SASH3 176..231 CDD:212901 11/70 (16%)
SAM_superfamily 250..317 CDD:301707 20/78 (26%)
SAM 252..316 CDD:197735 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.