DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckn and Ostf1

DIOPT Version :9

Sequence 1:NP_611009.1 Gene:ckn / 36673 FlyBaseID:FBgn0033987 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_059071.1 Gene:Ostf1 / 20409 MGIID:700012 Length:215 Species:Mus musculus


Alignment Length:165 Identity:40/165 - (24%)
Similarity:58/165 - (35%) Gaps:39/165 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 IPSTPSYVPTTRVSWDDTKIYATSSVLNSTAPSGS-----SCLNSSL-ANG-DAYYCTGSNHECC 474
            |||  :||.....|.|:.        |:..|..|:     .||::.: .|| |....|.....|.
Mouse    61 IPS--NYVAEQAESIDNP--------LHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACH 115

  Fly   475 SGN-DVVLIKVRQPRGKSLESLEDIHDNSTRS----------HLTFSHYTTTDYGHFGPPTTAAA 528
            .|: |:|.:...|| ...|.....:.|.:..:          .|..:....||..: .....|..
Mouse   116 GGHKDIVEVLFTQP-NVELNQQNKLGDTALHAAAWKGYADIVQLLLAKGARTDLRN-NEKKLALD 178

  Fly   529 AAAMAAAATLQQQHHHQQLLHQQQQQAAAARLLGN 563
            .|..||.|:         ||.::||....||.|.|
Mouse   179 MATNAACAS---------LLKKKQQGTDGARTLSN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cknNP_611009.1 SAM_caskin1,2_repeat1 254..319 CDD:188896
SAM 260..316 CDD:197735
SAM_caskin1,2_repeat2 320..390 CDD:188897
SAM 326..387 CDD:197735
Caskin-tail <887..912 CDD:293238
Ostf1NP_059071.1 SH3_OSTF1 16..68 CDD:212706 5/8 (63%)
ANK 1 72..101 7/36 (19%)
ANK 75..189 CDD:238125 25/132 (19%)
ANK repeat 76..103 CDD:293786 7/34 (21%)
ANK repeat 105..137 CDD:293786 8/32 (25%)
ANK 2 105..135 8/30 (27%)
ANK repeat 139..170 CDD:293786 4/30 (13%)
ANK 3 139..168 3/28 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..215 6/13 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845964
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24155
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.