DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckn and Y106G6H.14

DIOPT Version :9

Sequence 1:NP_611009.1 Gene:ckn / 36673 FlyBaseID:FBgn0033987 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_492738.1 Gene:Y106G6H.14 / 172926 WormBaseID:WBGene00013724 Length:220 Species:Caenorhabditis elegans


Alignment Length:244 Identity:47/244 - (19%)
Similarity:77/244 - (31%) Gaps:84/244 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 APPPGAGKPGVAMVPPPPVFCATLREPLTHKAAVYYHQQLALQEDQGIDLTQSPG------RDSP 194
            ||||.|.|||...|                ..|:|..|..:.||     ||.|.|      .:.|
 Worm     8 APPPPAPKPGRVKV----------------YRALYDFQARSAQE-----LTFSEGDLMYVSDEQP 51

  Fly   195 GSSSGSAGSGSRHSTASLDSGRASSYLTGVSSSGASIRAPLSSP----RCSSVSSC-----SIGS 250
            ......|..|.:....      .::|:  :|.:...:..||...    ....::.|     |:.|
 Worm    52 NKDWFQASIGGKKGLV------PANYV--ISENVEELPNPLHEAARRGNMDMLAECLRERVSVNS 108

  Fly   251 VDRQRNDELIIDWLLEMKHEEYAQLFIAAGYDLPTIARMTPEDLTAIGIKN-----PHHRERIKQ 310
            :|:.....|.  |   ..|..:|          |.:..:..:...|:.::|     |.|....|.
 Worm   109 LDKSGATPLY--W---ASHGGHA----------PAVDTLLKDPKVAVSVQNKLGDTPLHAAAYKG 158

  Fly   311 RIDKLQVLDNLPHFVPGSIEEWLQLLRLEEYIQPLL-EQNYKTVRDVTQ 358
            .::.:::|                   |.....|.: .|:.|...|||:
 Worm   159 HVECVRLL-------------------LASSANPFVRNQDQKLPSDVTK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cknNP_611009.1 SAM_caskin1,2_repeat1 254..319 CDD:188896 10/69 (14%)
SAM 260..316 CDD:197735 9/60 (15%)
SAM_caskin1,2_repeat2 320..390 CDD:188897 7/40 (18%)
SAM 326..387 CDD:197735 7/34 (21%)
Caskin-tail <887..912 CDD:293238
Y106G6H.14NP_492738.1 SH3_OSTF1 21..74 CDD:212706 14/81 (17%)
ANK 82..196 CDD:238125 24/141 (17%)
ANK repeat 83..110 CDD:293786 5/26 (19%)
Ank_2 84..177 CDD:289560 18/126 (14%)
ANK repeat 112..144 CDD:293786 6/46 (13%)
ANK repeat 146..177 CDD:293786 6/49 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.