DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10257 and FAIM

DIOPT Version :9

Sequence 1:NP_611008.2 Gene:CG10257 / 36671 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_011511252.1 Gene:FAIM / 55179 HGNCID:18703 Length:233 Species:Homo sapiens


Alignment Length:213 Identity:75/213 - (35%)
Similarity:125/213 - (58%) Gaps:12/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SPTLRL-----ENLSTQPTMTQDHVPEDQRYNKQNIVAQWCVPINGKMYRIELEHGTTSGRRMIW 64
            |.||||     .:....|....|..|........::||.|.|.::..:::||.|||||||:|:::
Human    23 SATLRLFLPTMASGDDSPIFEDDESPPYSLEKMTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVY 87

  Fly    65 VNGREVLRRDWMFKLVGEDTFHID--QTRCIIRVDPAPGFKYEYSLYIDGKSHDQYTEDMTRQYR 127
            |:|:|.:|::|||||||::||::.  :|:..|.:|...||.|||:|.|:|||..:|.||.::...
Human    88 VDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTN 152

  Fly   128 LWLYTDDAAADAPQEYRIMLKLDTLSLYVNDELRTEESVFVHGGTDTKFLLQDTEFVLQARSSGN 192
            .|:...|.     :.:||:|:.|.:.::.|.:.......||..||:|.|.:.:.:..::|.|||.
Human   153 TWVLHMDG-----ENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGK 212

  Fly   193 KHDGIVHTLLANGVAVPE 210
            :.:||:|||:.:...:||
Human   213 RKEGIIHTLIVDNREIPE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 65/175 (37%)
FAIMXP_011511252.1 FAIM1 57..228 CDD:284354 65/175 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150780
Domainoid 1 1.000 141 1.000 Domainoid score I4740
eggNOG 1 0.900 - - E1_KOG4352
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8018
Inparanoid 1 1.050 141 1.000 Inparanoid score I4494
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48789
OrthoDB 1 1.010 - - D1301275at2759
OrthoFinder 1 1.000 - - FOG0003977
OrthoInspector 1 1.000 - - oto89598
orthoMCL 1 0.900 - - OOG6_107504
Panther 1 1.100 - - LDO PTHR13088
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3445
SonicParanoid 1 1.000 - - X2734
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.