DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10257 and faimb

DIOPT Version :9

Sequence 1:NP_611008.2 Gene:CG10257 / 36671 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_005168767.1 Gene:faimb / 436668 ZFINID:ZDB-GENE-040718-91 Length:182 Species:Danio rerio


Alignment Length:182 Identity:75/182 - (41%)
Similarity:117/182 - (64%) Gaps:9/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NIVAQWCVPINGKMYRIELEHGTTSGRRMIWVNG--REVLRRDWMFKLVGEDTFHIDQT--RCII 94
            :||..|.|.::..:||||.|||:|:|:|:|::||  ||||||||||||||::||.:..|  :..|
Zfish     4 DIVGAWDVSLSDGLYRIEFEHGSTTGKRVIYINGKVREVLRRDWMFKLVGKETFPVGCTDAKATI 68

  Fly    95 RVDPAPGFKYEYSLYIDGKSHDQYTEDMTRQYRLWLYTDDAAADAPQEYRIMLKLDTLSLYVNDE 159
            .::...||.|||:|.|:|||...:.::.::..:.|:...|.|     :|||:|:.||:.::.|.:
Zfish    69 TIEAITGFSYEYTLEINGKSLQTFLDNRSKISKTWVMKLDGA-----DYRIVLEKDTMDVWCNGQ 128

  Fly   160 LRTEESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVPEA 211
            .......|...|::|.|.|.|.|..::|.:||.|.:||||:||.:|:.:.||
Zfish   129 KLETMGEFTENGSETHFALGDHECYIKATTSGRKRNGIVHSLLVDGIRIEEA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 73/177 (41%)
faimbXP_005168767.1 FAIM1 4..177 CDD:284354 73/177 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585311
Domainoid 1 1.000 149 1.000 Domainoid score I4378
eggNOG 1 0.900 - - E1_KOG4352
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4334
OMA 1 1.010 - - QHG48789
OrthoDB 1 1.010 - - D1301275at2759
OrthoFinder 1 1.000 - - FOG0003977
OrthoInspector 1 1.000 - - otm25408
orthoMCL 1 0.900 - - OOG6_107504
Panther 1 1.100 - - O PTHR13088
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2734
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.