DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lap1 and PIRL9

DIOPT Version :9

Sequence 1:NP_001188938.1 Gene:Lap1 / 36670 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_187741.2 Gene:PIRL9 / 820306 AraportID:AT3G11330 Length:499 Species:Arabidopsis thaliana


Alignment Length:323 Identity:100/323 - (30%)
Similarity:146/323 - (45%) Gaps:84/323 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EEVIDKLDYSNTPLTDFPEVWQHERTLEELYLSTTRLQALPPQLFYCQGLRVLHVNSNNLESIPQ 80
            |||:..|.:::.            ..::.:.||..:|:.||......|||.||::::|.|||||.
plant   186 EEVVGILQHASA------------NPVDRVDLSGRKLRLLPEAFGRIQGLLVLNLSNNKLESIPD 238

  Fly    81 AIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISLQELLLNETYLE 145
            :|..|..                       |..||:|.|||:.|||:|                 
plant   239 SIAGLHS-----------------------LVELDVSTNSLETLPDSI----------------- 263

  Fly   146 FLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVG-ELKSLRELWID 209
                  |.|..|:||.:..|.|.:||.|:.|..:|..||:..|..|.||..:| ||.:|.:|.:.
plant   264 ------GLLSKLKILNVSTNKLTSLPDSICRCGSLVILDVSFNRLTYLPTNIGPELVNLEKLLVQ 322

  Fly   210 FNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSN--SLEAFPFSVGMLKSL 272
            :|:||....:||::|.|:|.:|:.|.|:.||.......|:|.|::.||  .|:..|||.|.|.| 
plant   323 YNKIRSFPTSIGEMRSLKHLDAHFNELNGLPDSFVLLTNLEYLNLSSNFSDLKDLPFSFGELIS- 386

  Fly   273 VTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDEL 335
                                  |:||.||:|::..||.|.|.|.||..|..|.|.|...|:|:
plant   387 ----------------------LQELDLSNNQIHALPDTFGTLDSLTKLNVDQNPLVVPPEEV 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 49/179 (27%)
leucine-rich repeat 21..41 CDD:275380 1/19 (5%)
LRR_8 40..98 CDD:290566 18/57 (32%)
leucine-rich repeat 42..64 CDD:275380 5/21 (24%)
leucine-rich repeat 65..87 CDD:275380 11/21 (52%)
LRR_8 86..140 CDD:290566 11/53 (21%)
leucine-rich repeat 88..110 CDD:275380 0/21 (0%)
leucine-rich repeat 111..133 CDD:275380 11/21 (52%)
leucine-rich repeat 134..156 CDD:275380 2/21 (10%)
LRR_8 156..213 CDD:290566 22/57 (39%)
leucine-rich repeat 157..179 CDD:275380 9/21 (43%)
leucine-rich repeat 180..202 CDD:275380 10/22 (45%)
leucine-rich repeat 203..225 CDD:275380 7/21 (33%)
leucine-rich repeat 226..248 CDD:275380 7/21 (33%)
leucine-rich repeat 272..294 CDD:275380 0/21 (0%)
LRR_8 279..328 CDD:290566 16/48 (33%)
leucine-rich repeat 295..317 CDD:275380 11/21 (52%)
leucine-rich repeat 318..340 CDD:275380 7/18 (39%)
LRR_8 340..396 CDD:290566
leucine-rich repeat 364..386 CDD:275380
PDZ_signaling 770..846 CDD:238492
PIRL9NP_187741.2 leucine-rich repeat 202..222 CDD:275380 5/19 (26%)
LRR_RI 205..397 CDD:238064 83/260 (32%)
LRR_8 222..279 CDD:290566 29/102 (28%)
leucine-rich repeat 223..245 CDD:275380 11/21 (52%)
leucine-rich repeat 246..268 CDD:275380 13/44 (30%)
leucine-rich repeat 269..291 CDD:275380 9/21 (43%)
leucine-rich repeat 292..315 CDD:275380 10/22 (45%)
LRR_8 315..370 CDD:290566 18/54 (33%)
leucine-rich repeat 316..338 CDD:275380 7/21 (33%)
leucine-rich repeat 339..361 CDD:275380 7/21 (33%)
LRR_8 360..420 CDD:290566 28/82 (34%)
leucine-rich repeat 362..386 CDD:275380 10/23 (43%)
leucine-rich repeat 387..409 CDD:275380 11/21 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3538
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.