Sequence 1: | NP_001188938.1 | Gene: | Lap1 / 36670 | FlyBaseID: | FBgn0033984 | Length: | 849 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001311265.1 | Gene: | SHOC2 / 8036 | HGNCID: | 15454 | Length: | 582 | Species: | Homo sapiens |
Alignment Length: | 450 | Identity: | 130/450 - (28%) |
---|---|---|---|
Similarity: | 211/450 - (46%) | Gaps: | 56/450 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LSKCFPCFKFKREEVIDKLDYSNTPLTDFPEVWQHERTLEELYLSTTRLQALPPQLFYCQGLRVL 68
Fly 69 HVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLIS 133
Fly 134 LQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVG 198
Fly 199 ELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSEL-------------------- 243
Fly 244 -----------------------------SNWRNVEVLSICSNSLEAFPFSVGMLKSLVTFKCES 279
Fly 280 NGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDELCSCQQLSVL 344
Fly 345 SVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSMWLSDNQSQPLVPLQ 404 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lap1 | NP_001188938.1 | LRR_RI | <21..200 | CDD:238064 | 56/178 (31%) |
leucine-rich repeat | 21..41 | CDD:275380 | 4/19 (21%) | ||
LRR_8 | 40..98 | CDD:290566 | 21/57 (37%) | ||
leucine-rich repeat | 42..64 | CDD:275380 | 9/21 (43%) | ||
leucine-rich repeat | 65..87 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 86..140 | CDD:290566 | 15/53 (28%) | ||
leucine-rich repeat | 88..110 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 111..133 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 134..156 | CDD:275380 | 8/21 (38%) | ||
LRR_8 | 156..213 | CDD:290566 | 20/56 (36%) | ||
leucine-rich repeat | 157..179 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 180..202 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 203..225 | CDD:275380 | 4/21 (19%) | ||
leucine-rich repeat | 226..248 | CDD:275380 | 7/70 (10%) | ||
leucine-rich repeat | 272..294 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 279..328 | CDD:290566 | 22/48 (46%) | ||
leucine-rich repeat | 295..317 | CDD:275380 | 11/21 (52%) | ||
leucine-rich repeat | 318..340 | CDD:275380 | 8/21 (38%) | ||
LRR_8 | 340..396 | CDD:290566 | 20/55 (36%) | ||
leucine-rich repeat | 364..386 | CDD:275380 | 5/21 (24%) | ||
PDZ_signaling | 770..846 | CDD:238492 | |||
SHOC2 | NP_001311265.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..88 | ||
LRR 1 | 101..122 | 4/20 (20%) | |||
leucine-rich repeat | 104..124 | CDD:275380 | 4/19 (21%) | ||
PLN00113 | <115..>483 | CDD:215061 | 103/367 (28%) | ||
LRR 2 | 124..145 | 9/20 (45%) | |||
leucine-rich repeat | 125..147 | CDD:275380 | 9/21 (43%) | ||
LRR 3 | 147..169 | 6/21 (29%) | |||
leucine-rich repeat | 148..170 | CDD:275380 | 7/21 (33%) | ||
LRR 4 | 170..191 | 6/20 (30%) | |||
leucine-rich repeat | 171..193 | CDD:275380 | 6/21 (29%) | ||
LRR 5 | 193..214 | 6/20 (30%) | |||
leucine-rich repeat | 194..216 | CDD:275380 | 7/21 (33%) | ||
LRR 6 | 216..237 | 7/20 (35%) | |||
leucine-rich repeat | 217..239 | CDD:275380 | 8/21 (38%) | ||
LRR 7 | 239..260 | 8/20 (40%) | |||
leucine-rich repeat | 240..262 | CDD:275380 | 7/21 (33%) | ||
LRR 8 | 262..283 | 7/20 (35%) | |||
leucine-rich repeat | 263..285 | CDD:275380 | 8/21 (38%) | ||
LRR 9 | 285..307 | 5/21 (24%) | |||
leucine-rich repeat | 286..332 | CDD:275380 | 10/45 (22%) | ||
LRR 10 | 308..329 | 6/20 (30%) | |||
LRR 11 | 332..353 | 0/20 (0%) | |||
leucine-rich repeat | 333..380 | CDD:275380 | 1/46 (2%) | ||
LRR 12 | 356..377 | 0/20 (0%) | |||
LRR 13 | 380..400 | 4/19 (21%) | |||
leucine-rich repeat | 381..403 | CDD:275380 | 5/21 (24%) | ||
LRR 14 | 403..424 | 7/20 (35%) | |||
leucine-rich repeat | 404..426 | CDD:275380 | 7/21 (33%) | ||
LRR 15 | 426..448 | 10/21 (48%) | |||
leucine-rich repeat | 427..449 | CDD:275380 | 11/21 (52%) | ||
LRR 16 | 449..470 | 8/20 (40%) | |||
leucine-rich repeat | 450..472 | CDD:275380 | 8/21 (38%) | ||
PLN03150 | <453..527 | CDD:178695 | 25/73 (34%) | ||
LRR 17 | 472..494 | 10/21 (48%) | |||
leucine-rich repeat | 473..495 | CDD:275380 | 11/21 (52%) | ||
LRR 18 | 495..516 | 4/20 (20%) | |||
leucine-rich repeat | 496..519 | CDD:275380 | 5/22 (23%) | ||
LRR 19 | 518..540 | 6/18 (33%) | |||
LRR 20 | 542..563 | ||||
leucine-rich repeat | 543..563 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |