DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lap1 and LRRC7

DIOPT Version :9

Sequence 1:NP_001188938.1 Gene:Lap1 / 36670 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_001357714.1 Gene:LRRC7 / 57554 HGNCID:18531 Length:1575 Species:Homo sapiens


Alignment Length:996 Identity:298/996 - (29%)
Similarity:457/996 - (45%) Gaps:251/996 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLSKCFPCFKFK-REEVIDKLDYSNTPLTDFP-EVWQHERTLEELYLSTTRLQALPPQLFYCQGL 65
            ::.:..||..|: .||:|..||||:..|...| ||:..|||||||||...:::.||.|||.||.|
Human    45 IIGRLVPCRCFRGEEEIISVLDYSHCSLQQVPKEVFNFERTLEELYLDANQIEELPKQLFNCQAL 109

  Fly    66 RVLHVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITS 130
            |.|.:..|:|.::|..|.||..|:.||:::|.:...||.||.||.||.::.|.|.:.:|||..|.
Human   110 RKLSIPDNDLSNLPTTIASLVNLKELDISKNGVQEFPENIKCCKCLTIIEASVNPISKLPDGFTQ 174

  Fly   131 LISLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPE 195
            |::|.:|.||:.:||||||||||||.|||||||.|:|.||||||.:|..|:|||:|.|||.||||
Human   175 LLNLTQLYLNDAFLEFLPANFGRLVKLRILELRENHLKTLPKSMHKLAQLERLDLGNNEFGELPE 239

  Fly   196 VVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLE 260
            |:.::::|||||:|.|.::.:..:||||:.|.:.:.:.|.::|:..::|....:|.|.:.||.|:
Human   240 VLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQ 304

  Fly   261 AFPFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADD 325
            ..|.|:|:||.|.|.|.:.|.||.||::|..|..|||...|.|:|..||||||.|.|||.|..|:
Human   305 QLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSLLEEFDCSCNELESLPSTIGYLHSLRTLAVDE 369

  Fly   326 NQLRQLPDELCSCQQLSVLSVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSM 390
            |.|.:||.|:.||:.::|:|:.:|:|..||:.||.:.|::|||:.:|.:..||.|...|..|.::
Human   370 NFLPELPREIGSCKNVTVMSLRSNKLEFLPEEIGQMQKLRVLNLSDNRLKNLPFSFTKLKELAAL 434

  Fly   391 WLSDNQSQPLVPLQYLDASTKTQ---LTCFMLPQ-----VTFKMNS---------IQAQQQAQEQ 438
            |||||||:.|:||| .:|..:|:   ||.:|.||     ..|:.:|         .|.||:....
Human   435 WLSDNQSKALIPLQ-TEAHPETKQRVLTNYMFPQQPRGDEDFQSDSDSFNPTLWEEQRQQRMTVA 498

  Fly   439 YEFVYANQQQPHA---------------------SPSRRI--CFAEEATILSNAKAQPAP-NYPS 479
            :||....:...:|                     .|:|..  |....|......:..|.| |.|.
Human   499 FEFEDKKEDDENAGKVKDLSCQAPWERGQRGITLQPARLSGDCCTPWARCDQQIQDMPVPQNDPQ 563

  Fly   480 F-------------------VAAPPTPTPDQMAG---SVRLMRSPTPYPKELRQMSKYVR----- 517
            .                   |||..|..| .::|   .:.|.|.|||||::|:.|.|.|:     
Human   564 LAWGCISGLQQERSMCTPLPVAAQSTTLP-SLSGRQVEINLKRYPTPYPEDLKNMVKSVQNLVGK 627

  Fly   518 -----QAQAATSSANASE-----------------------VREARVVTNGQI------------ 542
                 :.:.:..:||..:                       |..|..:..|::            
Human   628 PSHGVRVENSNPTANTEQTVKEKYEHKWPVAPKEITVEDSFVHPANEMRIGELHPSLAETPLYPP 692

  Fly   543 ---------------------HCDSNNAN--------------------------QDVVDQATTS 560
                                 ||.:|:.:                          |.....|..:
Human   693 KLVLLGKDKKESTDESEVDKTHCLNNSVSSGTYSDYSPSQASSGSSNTRVKVGSLQTTAKDAVHN 757

  Fly   561 AIYG--IAPETTHIYGVYQQP--------QQMAHP---VPTQEYYGLPLV-----NYE--AHYQQ 605
            :::|  |||.       :.||        |:.|.|   :| |....||:.     |:.  :||..
Human   758 SLWGNRIAPS-------FPQPLDSKPLLSQREAVPPGNIP-QRPDRLPMSDTFTDNWTDGSHYDN 814

  Fly   606 L-YVEANT--------PLPTTHLNGDQDYELQPLQQQ------PM---QQQALPTPRLEPPPYHI 652
            . :|...|        ||.::.......:..:||.:|      |:   |.....||..|.||.:.
Human   815 TGFVAEETTAENANSNPLLSSKSRSTSSHGRRPLIRQDRIVGVPLELEQSTHRHTPETEVPPSNP 879

  Fly   653 ARVYTKKTP---EDLNLYESMRQR--------KQQQQLQEQT------------IYQDALNSNSN 694
            .:.:| :||   ||...:.|..:.        ::::.::|.|            .|.|: |.|.:
Human   880 WQNWT-RTPSPFEDRTAFPSKLETTPTTSPLPERKEHIKESTEIPSPFSPGVPWEYHDS-NPNRS 942

  Fly   695 FKT----------TAIGAQDVEESVDQLDYQNNISNNLEPNPEEEDQELD--DTMSQHSLNSTAT 747
            ...          ::.|...:.:|.::|   :.:..:::.|..::.|.:|  |..:....|....
Human   943 LSNVFSQIHCRPESSKGVISISKSTERL---SPLMKDIKSNKFKKSQSIDEIDIGTYKVYNIPLE 1004

  Fly   748 NNTSKASHKKSTWIFGVHKNP 768
            |..|.:.|      .|.|:.|
Human  1005 NYASGSDH------LGSHERP 1019

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 97/179 (54%)
leucine-rich repeat 21..41 CDD:275380 9/20 (45%)
LRR_8 40..98 CDD:290566 28/57 (49%)
leucine-rich repeat 42..64 CDD:275380 12/21 (57%)
leucine-rich repeat 65..87 CDD:275380 9/21 (43%)
LRR_8 86..140 CDD:290566 21/53 (40%)
leucine-rich repeat 88..110 CDD:275380 9/21 (43%)
leucine-rich repeat 111..133 CDD:275380 9/21 (43%)
leucine-rich repeat 134..156 CDD:275380 15/21 (71%)
LRR_8 156..213 CDD:290566 36/56 (64%)
leucine-rich repeat 157..179 CDD:275380 16/21 (76%)
leucine-rich repeat 180..202 CDD:275380 13/21 (62%)
leucine-rich repeat 203..225 CDD:275380 11/21 (52%)
leucine-rich repeat 226..248 CDD:275380 4/21 (19%)
leucine-rich repeat 272..294 CDD:275380 10/21 (48%)
LRR_8 279..328 CDD:290566 26/48 (54%)
leucine-rich repeat 295..317 CDD:275380 13/21 (62%)
leucine-rich repeat 318..340 CDD:275380 11/21 (52%)
LRR_8 340..396 CDD:290566 22/55 (40%)
leucine-rich repeat 364..386 CDD:275380 8/21 (38%)
PDZ_signaling 770..846 CDD:238492
LRRC7NP_001357714.1 leucine-rich repeat 64..85 CDD:275380 9/20 (45%)
LRR_8 85..140 CDD:338972 26/54 (48%)
leucine-rich repeat 86..108 CDD:275380 12/21 (57%)
leucine-rich repeat 109..131 CDD:275380 9/21 (43%)
LRR 130..440 CDD:227223 146/309 (47%)
leucine-rich repeat 132..177 CDD:275380 19/44 (43%)
leucine-rich repeat 178..200 CDD:275380 15/21 (71%)
leucine-rich repeat 201..223 CDD:275380 16/21 (76%)
leucine-rich repeat 224..246 CDD:275380 13/21 (62%)
leucine-rich repeat 247..269 CDD:275380 11/21 (52%)
leucine-rich repeat 270..292 CDD:275380 4/21 (19%)
leucine-rich repeat 316..336 CDD:275380 9/19 (47%)
leucine-rich repeat 339..361 CDD:275380 13/21 (62%)
leucine-rich repeat 362..384 CDD:275380 11/21 (52%)
leucine-rich repeat 385..407 CDD:275380 8/21 (38%)
leucine-rich repeat 408..430 CDD:275380 8/21 (38%)
PDZ_signaling 1485..1570 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 405 1.000 Inparanoid score I1905
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D148064at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105355
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.