| Sequence 1: | NP_001188938.1 | Gene: | Lap1 / 36670 | FlyBaseID: | FBgn0033984 | Length: | 849 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001002627.1 | Gene: | lrrc57 / 436900 | ZFINID: | ZDB-GENE-040718-372 | Length: | 238 | Species: | Danio rerio |
| Alignment Length: | 216 | Identity: | 62/216 - (28%) |
|---|---|---|---|
| Similarity: | 111/216 - (51%) | Gaps: | 9/216 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 229 FEANGNLLDTLPSELSN-WRNVEVLSICSNSLEAFPFSVGMLKSLVTFKCESNGLTELPDSISYL 292
Fly 293 EQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALPQN 357
Fly 358 IGNLSKMKVLNVVNNYINALPVSMLNLVNLTSMWLSDNQSQ-PLVPLQYLDASTKTQLTCFMLPQ 421
Fly 422 VTF---KMNSIQAQQQAQEQY 439 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lap1 | NP_001188938.1 | LRR_RI | <21..200 | CDD:238064 | |
| leucine-rich repeat | 21..41 | CDD:275380 | |||
| LRR_8 | 40..98 | CDD:290566 | |||
| leucine-rich repeat | 42..64 | CDD:275380 | |||
| leucine-rich repeat | 65..87 | CDD:275380 | |||
| LRR_8 | 86..140 | CDD:290566 | |||
| leucine-rich repeat | 88..110 | CDD:275380 | |||
| leucine-rich repeat | 111..133 | CDD:275380 | |||
| leucine-rich repeat | 134..156 | CDD:275380 | |||
| LRR_8 | 156..213 | CDD:290566 | |||
| leucine-rich repeat | 157..179 | CDD:275380 | |||
| leucine-rich repeat | 180..202 | CDD:275380 | |||
| leucine-rich repeat | 203..225 | CDD:275380 | |||
| leucine-rich repeat | 226..248 | CDD:275380 | 5/19 (26%) | ||
| leucine-rich repeat | 272..294 | CDD:275380 | 9/21 (43%) | ||
| LRR_8 | 279..328 | CDD:290566 | 24/48 (50%) | ||
| leucine-rich repeat | 295..317 | CDD:275380 | 12/21 (57%) | ||
| leucine-rich repeat | 318..340 | CDD:275380 | 7/21 (33%) | ||
| LRR_8 | 340..396 | CDD:290566 | 13/55 (24%) | ||
| leucine-rich repeat | 364..386 | CDD:275380 | 3/21 (14%) | ||
| PDZ_signaling | 770..846 | CDD:238492 | |||
| lrrc57 | NP_001002627.1 | LRR 1 | 10..36 | 5/16 (31%) | |
| LRR_RI | <37..191 | CDD:238064 | 48/154 (31%) | ||
| LRR 2 | 37..62 | 5/24 (21%) | |||
| leucine-rich repeat | 40..65 | CDD:275380 | 5/24 (21%) | ||
| LRR_8 | 62..119 | CDD:290566 | 26/56 (46%) | ||
| LRR 3 | 64..82 | 7/17 (41%) | |||
| leucine-rich repeat | 66..85 | CDD:275380 | 8/18 (44%) | ||
| LRR 4 | 83..106 | 12/22 (55%) | |||
| leucine-rich repeat | 86..108 | CDD:275380 | 12/21 (57%) | ||
| LRR 5 | 108..128 | 8/19 (42%) | |||
| leucine-rich repeat | 109..131 | CDD:275380 | 7/21 (33%) | ||
| LRR 6 | 129..152 | 7/22 (32%) | |||
| leucine-rich repeat | 132..154 | CDD:275380 | 7/21 (33%) | ||
| LRR 7 | 154..173 | 3/19 (16%) | |||
| leucine-rich repeat | 155..176 | CDD:275380 | 3/21 (14%) | ||
| LRR 8 | 174..199 | 6/27 (22%) | |||
| leucine-rich repeat | 177..198 | CDD:275380 | 6/23 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||