DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lap1 and f-cup

DIOPT Version :9

Sequence 1:NP_001188938.1 Gene:Lap1 / 36670 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_001262544.1 Gene:f-cup / 41677 FlyBaseID:FBgn0028487 Length:802 Species:Drosophila melanogaster


Alignment Length:873 Identity:194/873 - (22%)
Similarity:308/873 - (35%) Gaps:261/873 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EVWQHERTLEELYLSTTRLQALPPQLFYCQGLRVLHVNSNNLESIPQAIGSLRQL--QHLDLNRN 96
            |:|:..|....|.||...|..:|.:|:          :.|..::..:|: :|.||  :..|...|
  Fly   101 ELWKLARKSGTLNLSNKALARVPKRLY----------DINEADADSKAV-NLEQLTIKEEDAWWN 154

  Fly    97 LIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISLQELLLNETYLEFLPANFGRLVNLRILE 161
               .||        |.:||||.|:|..:...|.:|.||..|.|::..|..||...|:|..|..|.
  Fly   155 ---QVP--------LNNLDLSSNTLTHISPKIENLQSLTVLTLHDNALVELPPEIGKLEKLVRLN 208

  Fly   162 LRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGELKSLRELWIDFNQIRRVSANIGKLRDL 226
            :..|.|..||::|..|..|:.|:|..|||.||...:.:|..|..|....|.|:.:...||.|..|
  Fly   209 VSHNKLSQLPRAMYSLPELRHLNISYNEFVELNPDISDLHMLEFLDGGHNNIQSLPGGIGFLVRL 273

  Fly   227 QHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPFSVGMLKSLVTFKCESNGLTELPDSISY 291
            .......|.:..||.:|.|.|:::.:.:..|.|.:.|..:|:|:.|.....:.|.:.|||: ...
  Fly   274 TALLLPYNHIKELPPDLVNMRSLQKIDLMHNDLTSLPEDMGLLRKLDCLYLQHNDILELPE-FEG 337

  Fly   292 LEQLEELVLSHNKLIRLPSTI-GMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALP 355
            .|.|.||..|:|.:..:|..: ..|..|:.|...||::.:||||||..:.|:.|.|:||.:|.||
  Fly   338 NEALNELHASNNFIKIIPKAMCSNLPHLKILDLRDNKITELPDELCLLRNLNRLDVSNNTISVLP 402

  Fly   356 QNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSMWLSDNQSQPLVPLQ-----YLDASTKTQLT 415
            ..:.:|:.:..|.|..|.|..:...:|...  |:..|.....:.:...:     ..||||...::
  Fly   403 VTLSSLAHLISLQVEGNPIKTIRRDILQCG--TTRILKTLHDRAVAKAKEEGGGVDDASTSAGIS 465

  Fly   416 CFML----------PQVTFKMNSIQAQQQAQEQYEFVYANQQQPHASPSRRICFAEEATILSNAK 470
            ...|          |. .|..:....|||...|....|..|||   ...::.|..|         
  Fly   466 VTRLRGGQMDDGDIPG-NFPDSFHHQQQQNGFQCPCSYPCQQQ---QMQQQFCVYE--------- 517

  Fly   471 AQPAPNYPSFVAAPPTPTPDQMAGSVRLMRSPTPYPKELRQMSKYVRQAQAATSSANASEVREAR 535
                                                 .||...:|.||                 
  Fly   518 -------------------------------------PLRNCQEYDRQ----------------- 528

  Fly   536 VVTNGQIHCDSNNANQDVVDQATTSAIYGIAPETTHIYGVYQQPQQMAHPVPTQEYYGLPLVNYE 600
              |.|:|:...|...|.  ...:..:::           |.||.|:|.:|.|          .|.
  Fly   529 --TQGRIYEPENYQQQH--QNGSLRSLF-----------VQQQQQRMEYPYP----------GYF 568

  Fly   601 AHYQQLYVEANTPLPTTHLNGDQDYELQPLQQQPMQQQALPTPRLEPPPYHIARVYTKKTPEDLN 665
            .:.||                         |||....:..|:.|....|..:             
  Fly   569 MYQQQ-------------------------QQQQFSYEQDPSSRSAVHPRWV------------- 595

  Fly   666 LYESMRQRKQQQQLQEQT-----IYQDALN--------SNSNFKTTAIGAQDVEESVDQLDYQNN 717
             |:....|.....|:|.|     ::|.|.:        :.:...|...|.|.:::.|.:|...||
  Fly   596 -YKLRHTRTLAVNLEELTSVPDQVFQIARDEGVHVVDFARNQLSTLPNGLQHMKDLVTELVLSNN 659

  Fly   718 I-------------------SNNLEPNPEEEDQELDDTMSQHS-LNSTATNNTSKASHKKSTWIF 762
            :                   ||||          |:|..::.. ||:....|.:.          
  Fly   660 VIGYVPQFISQFTRISFLNLSNNL----------LNDLPTEFGVLNTLRELNIAN---------- 704

  Fly   763 GVHKNPTVK---------QVTLKWENSIGFDIAELLNQVGIFVSSITPNTNAARLLNLNDKLLEI 818
              ::.|.:.         ::.:..||.|     ::||..|:        .|..||..|       
  Fly   705 --NRFPCIPNCVYELQGLEILIASENHI-----KMLNVSGL--------QNMRRLSTL------- 747

  Fly   819 DGYDLTNANLSDAKRVLLNCGTVMNIML 846
               ||.|.::.....:|.|...:.::.|
  Fly   748 ---DLRNNDIETVPPILGNLTNITHLEL 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 52/167 (31%)
leucine-rich repeat 21..41 CDD:275380 2/6 (33%)
LRR_8 40..98 CDD:290566 14/59 (24%)
leucine-rich repeat 42..64 CDD:275380 6/21 (29%)
leucine-rich repeat 65..87 CDD:275380 3/21 (14%)
LRR_8 86..140 CDD:290566 18/55 (33%)
leucine-rich repeat 88..110 CDD:275380 5/23 (22%)
leucine-rich repeat 111..133 CDD:275380 9/21 (43%)
leucine-rich repeat 134..156 CDD:275380 8/21 (38%)
LRR_8 156..213 CDD:290566 20/56 (36%)
leucine-rich repeat 157..179 CDD:275380 8/21 (38%)
leucine-rich repeat 180..202 CDD:275380 9/21 (43%)
leucine-rich repeat 203..225 CDD:275380 7/21 (33%)
leucine-rich repeat 226..248 CDD:275380 6/21 (29%)
leucine-rich repeat 272..294 CDD:275380 5/21 (24%)
LRR_8 279..328 CDD:290566 16/49 (33%)
leucine-rich repeat 295..317 CDD:275380 7/22 (32%)
leucine-rich repeat 318..340 CDD:275380 10/21 (48%)
LRR_8 340..396 CDD:290566 16/55 (29%)
leucine-rich repeat 364..386 CDD:275380 5/21 (24%)
PDZ_signaling 770..846 CDD:238492 15/84 (18%)
f-cupNP_001262544.1 leucine-rich repeat 111..140 CDD:275380 8/39 (21%)
LRR_RI 155..>377 CDD:238064 73/230 (32%)
leucine-rich repeat 158..180 CDD:275380 9/21 (43%)
LRR_8 180..235 CDD:290566 20/54 (37%)
leucine-rich repeat 181..203 CDD:275380 8/21 (38%)
leucine-rich repeat 204..226 CDD:275380 8/21 (38%)
LRR_8 225..283 CDD:290566 18/57 (32%)
leucine-rich repeat 227..249 CDD:275380 9/21 (43%)
leucine-rich repeat 250..272 CDD:275380 7/21 (33%)
LRR_8 272..329 CDD:290566 14/56 (25%)
leucine-rich repeat 273..295 CDD:275380 6/21 (29%)
leucine-rich repeat 296..318 CDD:275380 5/21 (24%)
LRR_8 317..375 CDD:290566 17/58 (29%)
leucine-rich repeat 319..340 CDD:275380 5/21 (24%)
leucine-rich repeat 341..364 CDD:275380 7/22 (32%)
leucine-rich repeat 389..410 CDD:275380 8/20 (40%)
leucine-rich repeat 411..430 CDD:275380 4/18 (22%)
leucine-rich repeat 627..650 CDD:275380 3/22 (14%)
leucine-rich repeat 651..669 CDD:275380 4/17 (24%)
leucine-rich repeat 697..719 CDD:275380 2/33 (6%)
LRR_8 719..777 CDD:290566 16/77 (21%)
leucine-rich repeat 720..743 CDD:275380 7/35 (20%)
leucine-rich repeat 744..766 CDD:275380 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47116
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.