DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADPS and Dhcr24

DIOPT Version :9

Sequence 1:NP_001188935.1 Gene:ADPS / 36669 FlyBaseID:FBgn0033983 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_444502.2 Gene:Dhcr24 / 74754 MGIID:1922004 Length:516 Species:Mus musculus


Alignment Length:152 Identity:32/152 - (21%)
Similarity:60/152 - (39%) Gaps:38/152 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 VGQDLERVLRSEGLTVGHEPDSYEFSTLGGWVATRASGMKKNVYGNIEDLVVRVRMVTPSGTLER 300
            :|| :..:|.|.|.|:...|:..:. |:||.:.........:.||..:.:.....::...|:.  
Mouse   139 MGQ-VTALLNSIGWTLPVLPELDDL-TVGGLIMGTGIESSSHKYGLFQHICTAYELILADGSF-- 199

  Fly   301 ECSAPRVSCGP----DFNHVILGSEGTLGVITEVVLKVRPLPSLRRYGSLAFP------------ 349
                  |.|.|    |..:.:..|.||||.:  |..::|.:|: ::|..|.|.            
Mouse   200 ------VRCTPSENSDLFYAVPWSCGTLGFL--VAAEIRIIPA-KKYVKLRFEPVRGLEAICEKF 255

  Fly   350 ---------NFEQGVLFMREVA 362
                     :|.:|:|:..:.|
Mouse   256 TRESQRLENHFVEGLLYSLDEA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADPSNP_001188935.1 GlcD 152..612 CDD:223354 32/152 (21%)
FAD_binding_4 159..300 CDD:279851 13/63 (21%)
FAD-oxidase_C 337..608 CDD:280983 8/47 (17%)
Dhcr24NP_444502.2 GlcD 114..>270 CDD:223354 29/143 (20%)
FAD_binding_4 <114..203 CDD:279851 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.