DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADPS and Gulo

DIOPT Version :9

Sequence 1:NP_001188935.1 Gene:ADPS / 36669 FlyBaseID:FBgn0033983 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_071556.2 Gene:Gulo / 60671 RGDID:620701 Length:440 Species:Rattus norvegicus


Alignment Length:209 Identity:58/209 - (27%)
Similarity:91/209 - (43%) Gaps:21/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 WHHKFRRIPDLVVWPRCHDEVVQLVRLANKHNVMLVPFGGGTSVSGAITCPQNESRMICALDTSQ 215
            |...:...|::...|...:||.:::.||.:....:...|||.|.|. |.|  .:..||   ...:
  Rat    13 WAKTYGCSPEVYYQPTSVEEVREVLALAREQKKKVKVVGGGHSPSD-IAC--TDGFMI---HMGK 71

  Fly   216 MNRLLWLNRENLTVCFESGIVGQDLERVLRSEGL---TVGHEPDSYEFSTLGGWVATRASGMKKN 277
            |||:|.:::|...|..|:||:..||...|...||   .:|...|......:|.  .|..:|:|  
  Rat    72 MNRVLQVDKEKKQVTVEAGILLADLHPQLDEHGLAMSNLGAVSDVTVAGVIGS--GTHNTGIK-- 132

  Fly   278 VYGNIEDLVVRVRMVTPSGTLERECSAPRVSCGPDFNHVILGSEGTLGVITEVVLKVRPLPSLRR 342
             :|.:...||.:.::|..|.: .|||..|   ..|.........|.||:|..|.|:..|...|: 
  Rat   133 -HGILATQVVALTLMTADGEV-LECSESR---NADVFQAARVHLGCLGIILTVTLQCVPQFHLQ- 191

  Fly   343 YGSLAFPNFEQGVL 356
              ..:||:..:.||
  Rat   192 --ETSFPSTLKEVL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADPSNP_001188935.1 GlcD 152..612 CDD:223354 57/208 (27%)
FAD_binding_4 159..300 CDD:279851 40/143 (28%)
FAD-oxidase_C 337..608 CDD:280983 5/20 (25%)
GuloNP_071556.2 FAD_lactone_ox 7..433 CDD:273751 58/209 (28%)
FAD_binding_4 21..156 CDD:279851 41/146 (28%)
ALO 180..438 CDD:281959 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.