DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADPS and dhcr24

DIOPT Version :9

Sequence 1:NP_001188935.1 Gene:ADPS / 36669 FlyBaseID:FBgn0033983 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_001008645.1 Gene:dhcr24 / 494102 ZFINID:ZDB-GENE-041212-73 Length:516 Species:Danio rerio


Alignment Length:104 Identity:29/104 - (27%)
Similarity:50/104 - (48%) Gaps:8/104 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 VGQDLERVLRSEGLTVGHEPDSYEFSTLGGWVATRASGMKKNVYGNIEDLVVRVRMVTPSGTLER 300
            :|| :..:|.|.|.|:...|:..:. |:||.|.........::||..:.:.|...:|...|:|.|
Zfish   139 MGQ-VTALLNSIGWTLPVLPELDDL-TVGGLVMGTGIESSSHIYGLFQHICVAFELVLADGSLVR 201

  Fly   301 ECSAPRVSCGPDFNHVILGSEGTLGVITEVVLKVRPLPS 339
             |:....|   |..:.:..|.||||.:  |..::|.:|:
Zfish   202 -CTEKENS---DLFYAVPWSCGTLGFL--VAAEIRIIPA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADPSNP_001188935.1 GlcD 152..612 CDD:223354 29/104 (28%)
FAD_binding_4 159..300 CDD:279851 17/63 (27%)
FAD-oxidase_C 337..608 CDD:280983 1/3 (33%)
dhcr24NP_001008645.1 FAD_binding_4 <114..203 CDD:279851 18/66 (27%)
GlcD 118..503 CDD:223354 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.