DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADPS and Gulo

DIOPT Version :9

Sequence 1:NP_001188935.1 Gene:ADPS / 36669 FlyBaseID:FBgn0033983 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_848862.1 Gene:Gulo / 268756 MGIID:1353434 Length:440 Species:Mus musculus


Alignment Length:191 Identity:57/191 - (29%)
Similarity:85/191 - (44%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 WHHKFRRIPDLVVWPRCHDEVVQLVRLANKHNVMLVPFGGGTSVSGAITCPQNESRMICALDTSQ 215
            |...:...|::...|....||.:::.||.:.|..:...|||.|.|. |.|  .:..||   ...:
Mouse    13 WAKTYGCSPEMYYQPTSVGEVREVLALARQQNKKVKVVGGGHSPSD-IAC--TDGFMI---HMGK 71

  Fly   216 MNRLLWLNRENLTVCFESGIVGQDLERVLRSEGL---TVGHEPDSYEFSTLGGWV--ATRASGMK 275
            |||:|.:::|...|..|:||:..||...|...||   .:|...|    .|:||.:  .|..:|:|
Mouse    72 MNRVLQVDKEKKQVTVEAGILLTDLHPQLDKHGLALSNLGAVSD----VTVGGVIGSGTHNTGIK 132

  Fly   276 KNVYGNIEDLVVRVRMVTPSGTLERECSAPRVSCGPDFNHVILGSEGTLGVITEVVLKVRP 336
               :|.:...||.:.::...||: .|||.   |...|.........|.||||..|.|:..|
Mouse   133 ---HGILATQVVALTLMKADGTV-LECSE---SSNADVFQAARVHLGCLGVILTVTLQCVP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADPSNP_001188935.1 GlcD 152..612 CDD:223354 56/190 (29%)
FAD_binding_4 159..300 CDD:279851 43/145 (30%)
FAD-oxidase_C 337..608 CDD:280983 57/191 (30%)
GuloNP_848862.1 FAD_lactone_ox 7..433 CDD:273751 57/191 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.