DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agps and Y7A5A.1

DIOPT Version :10

Sequence 1:NP_611006.1 Gene:Agps / 36669 FlyBaseID:FBgn0033983 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_510594.1 Gene:Y7A5A.1 / 181666 WormBaseID:WBGene00012407 Length:538 Species:Caenorhabditis elegans


Alignment Length:162 Identity:39/162 - (24%)
Similarity:71/162 - (43%) Gaps:34/162 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 PQNESRMIC-------ALDTS------------QMNRLLWLNRENLTVCFESGIVGQDLERVLRS 246
            |.:|.:.:|       :|.|:            .::.:|.|:.:||||..|..|..:::.:.|..
 Worm    71 PDSEQKPLCTARPNWLSLSTTFFDKRKCHQVPIDLHDVLSLDEKNLTVTVEPNITVREICKFLIP 135

  Fly   247 EGLTVGHEPDSYEFSTLGGWVATRASGMKKNVY----GNIEDLVVRVRMVTPSGTLERECSAPRV 307
            :|.|:....:..: :||||    .|.|:....|    |..::.:|...:||..|.:.....:...
 Worm   136 KGYTLAVTLEIGD-ATLGG----LAFGVGMTTYSHKVGLYQEAIVSYEVVTADGNVITVTDSNEH 195

  Fly   308 SCGPDFNHVILGSEGTLGV---ITEVVLKVRP 336
            |   |..:.:..|.||||.   :|..::||:|
 Worm   196 S---DLFYCLPWSHGTLGFLVGLTLRIVKVKP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgpsNP_611006.1 GlcD 155..610 CDD:440046 39/162 (24%)
Y7A5A.1NP_510594.1 GlcD 105..>226 CDD:440046 34/128 (27%)

Return to query results.
Submit another query.