DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp317a1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001286435.1 Gene:Cyp317a1 / 36667 FlyBaseID:FBgn0033982 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:313 Identity:64/313 - (20%)
Similarity:120/313 - (38%) Gaps:84/313 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFLIIGLLVLGLLVLLIIAARYQRDYWRYLDIPHERPKKL-------------WPIIRQIMTQT- 54
            |..:..:.::|.|:|::      ...||.::....|||:|             :.|:...|.:: 
plant     4 IITVRKVFLIGFLILIL------NWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESN 62

  Fly    55 ----------LSTEA------MKAEHYSAI---YKKFKGSGPFCGFYALLQPRALILDRELIRQI 100
                      |..:|      |...|::.:   .|.|...||:        |..:::|.|.:|:|
plant    63 QMDQVAHSLPLPLDADFLPRMMPFLHHTVLKHGKKCFTWYGPY--------PNVIVMDPETLREI 119

  Fly   101 MIKDFWNFNDRGLYCNQKSDP-----LSGDLYALRGESWKEMRQKLDPSLEGDRMSLLY-----D 155
            |.|       ..|:...|...     ||| |....|..|.:.|..|:|:...|.:..:.     .
plant   120 MSK-------HELFPKPKIGSHNHVFLSG-LLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSS 176

  Fly   156 C--LYEEAEQLLLTVNSTLMSQPHSTVHIQKIMRRYVLSSLAKCVFGLNAEQR-KTYPLEDFEQM 217
            |  :.||.|: |.:...|:  :..|..|...:.|    :.||:..||.:.:.. |.:.::  ::.
plant   177 CKEMLEEWER-LASAKGTM--ELDSWTHCHDLTR----NMLARASFGDSYKDGIKIFEIQ--QEQ 232

  Fly   218 TELALNSHKHGYLMNLMMIRFPNFCRMLRMRRTPKQAEEYFIKLLTSIVEQRE 270
            .:|.|.:.:..|:.....:. ..|.|  |:|.|.:.....|    .:::|.:|
plant   233 IDLGLLAIRAVYIPGSKFLP-TKFNR--RLRETERDMRAMF----KAMIETKE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp317a1NP_001286435.1 p450 39..466 CDD:299894 58/278 (21%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.