DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp317a1 and CYP705A28

DIOPT Version :9

Sequence 1:NP_001286435.1 Gene:Cyp317a1 / 36667 FlyBaseID:FBgn0033982 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:295 Identity:70/295 - (23%)
Similarity:130/295 - (44%) Gaps:58/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 TPKQAEEYFIKLLTSIVEQRETSGKPQKDYLQLLIDVKALEF-------------------ITHQ 295
            :|| .:|...|.|....|:.|.......|.:.||::...:..                   |..:
plant    57 SPK-FDELLEKFLVEHEEKMEEDHYKANDMMDLLLEAMEMRMQNVNLCIKRVSNTKARKPPILFR 120

  Fly   296 YEADKELGAHLQNELAAHAVVFLKAGYEQTANTLSYVLYELALHPELQVRVREEVKKAIERHDGH 360
            |      |.:..|.|....:  |.||.:.:|....:.:.||..:|.:..|:|||::..:    |:
plant   121 Y------GKYSNNSLLLQEL--LVAGTDTSALATQWTMAELINNPTILERLREEIESVV----GN 173

  Fly   361 ---ITHEGIKSLSFMGQVINETLRMHPITPYILRRT-----LNDYAVPDHPKYILVKELFLIIPT 417
               |....:.:|.::..|:.|.||:||.....:|.:     |..:.:|:        :..|::.|
plant   174 TRLIQETDLSNLPYLQSVVKEGLRLHPPASISVRMSQERCELGGFYIPE--------KTLLVVNT 230

  Fly   418 HAIHHDPDIYPDPEEFKPDRW-----SGPRDSLQEQG-TWFGFGVGARSCIGIQFAQLQLRLALA 476
            :||..||:.:.|||||||:|:     |...|.::|:. .:..|..|.|.|.|...|.:.|.:|:.
plant   231 YAIMRDPNFWEDPEEFKPERFITSSRSEQEDEMREEVLKYIPFSAGRRGCPGSNLAYVSLGIAIG 295

  Fly   477 LLLSEYEFSLNTRKPLINLEDGIALTLMPLGVIEP 511
            :::..:::.:...|  :|:.: .|.|:| |.:.:|
plant   296 VMVQCFDWRIKGEK--VNMSE-TAGTIM-LAMAQP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp317a1NP_001286435.1 p450 39..466 CDD:299894 60/248 (24%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 70/295 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.