DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp317a1 and erg5

DIOPT Version :9

Sequence 1:NP_001286435.1 Gene:Cyp317a1 / 36667 FlyBaseID:FBgn0033982 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_593788.2 Gene:erg5 / 2542469 PomBaseID:SPAC19A8.04 Length:543 Species:Schizosaccharomyces pombe


Alignment Length:257 Identity:65/257 - (25%)
Similarity:125/257 - (48%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 MIRFP---NFCRMLRMRRTPKQAEEYFIKLLTSIVEQRETSGKP---QKDYLQLLIDVKALEFIT 293
            ::.||   .|.::....::.|....||:|......:..|....|   .::::..:|:       |
pombe   228 LVNFPIVLPFTKVWYGIQSRKVVMRYFMKAAAESRKNMEAGNAPACMMEEWIHEMIE-------T 285

  Fly   294 HQYEADKELGAH---------LQNELAAHAVVFLKAGYEQTANTLSYVLYELALHPELQVRVREE 349
            .:|:::.:.||.         ...|::...:.||.|..:.|::.::::...||.||::..:||||
pombe   286 RKYKSENKEGAEKPSVLIREFSDEEISLTFLSFLFASQDATSSAMTWLFQLLADHPDVLQKVREE 350

  Fly   350 ---VKKAIERHDGHITHEGIKSLSFMGQVINETLRMHP---ITPYILRRTLNDYAVPDHPKYILV 408
               ::|.  ..|..::.:.::.:::...|:.|.||:.|   :.||.:::     |.|..|.|.:.
pombe   351 QLRIRKG--DIDVPLSLDLMEKMTYTRAVVKECLRLRPPVLMVPYRVKK-----AFPITPDYTVP 408

  Fly   409 KELFLIIPT-HAIHHDPDIYPDPEEFKPDRWSGPRDSLQEQG--TWFGFGVGARSCIGIQFA 467
            |:. ::||| :...||..:||:||.|.||||:  .:.|.||.  .|..||.|...|:|.::|
pombe   409 KDA-MVIPTLYGALHDSKVYPEPETFNPDRWA--PNGLAEQSPKNWMVFGNGPHVCLGQRYA 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp317a1NP_001286435.1 p450 39..466 CDD:299894 64/254 (25%)
erg5NP_593788.2 CypX 57..505 CDD:225035 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.