DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp317a1 and tbxas1

DIOPT Version :9

Sequence 1:NP_001286435.1 Gene:Cyp317a1 / 36667 FlyBaseID:FBgn0033982 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_031753608.1 Gene:tbxas1 / 100327243 XenbaseID:XB-GENE-994325 Length:532 Species:Xenopus tropicalis


Alignment Length:557 Identity:143/557 - (25%)
Similarity:249/557 - (44%) Gaps:112/557 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIIGLLVLGLLVLLIIAARYQRDYWRYLDIPHERPKKLWPIIRQIMTQTLSTEAMKAEHYSAIYK 70
            |:.|.  ||||....::|     :|:......:.||.| |.|..||                :::
 Frog    18 LVAGF--LGLLYWYSVSA-----FWQLEKAGIKHPKPL-PFIGNIM----------------LFQ 58

  Fly    71 K---------FKGSGPFCGFYALLQPRALILDRELIRQIMIKDFWNFNDRGLYCNQKSDPLSGDL 126
            |         .|..||.||:|...:|..:|.:.:.|:|::.|||.||.:|....|..:.|:|..|
 Frog    59 KGFWEGDRHLLKTYGPICGYYMGRRPMIVIAEPDAIKQVLQKDFVNFTNRMQRLNLVTKPMSDSL 123

  Fly   127 YALRGESWKEMRQKLDPSLEGDRMS----LLYDCLYEEAEQLLLTVNSTLMSQPHSTVHIQKIMR 187
            ..||.:.||.:|..|.||....||.    |:..|.....|.|:...:|      ....::|:...
 Frog   124 LCLRDDKWKRVRSVLTPSFSAARMKEMCPLINQCCDVLVENLMEYASS------GEACNVQRCYA 182

  Fly   188 RYVLSSLAKCVFG--LNAEQRKTYPL-EDFEQMTELALNSHKHGYLMNLMMIRFPNFCRMLRM-R 248
            .:.:..:|...||  :::::...:|| ::.::..|| ....|.   :.|:.:.||:.  |:.: |
 Frog   183 CFTMDVVASVAFGTQVDSQRDSDHPLVQNCKRFLEL-FTPFKP---VVLLCLAFPSI--MIPIAR 241

  Fly   249 RTPKQAEE----YFIKLLTSIVEQRETS--GKPQKDYLQLLIDVK------ALEFITHQYEAD-- 299
            |.|.:..:    :|:|::..|:..||..  .:.::|:|||::|.:      :::......:||  
 Frog   242 RLPNKHRDRINSFFLKVIRDIIAFRENQPPNERRRDFLQLMLDARDSAGHVSVDHFDIVNQADLS 306

  Fly   300 -----------------KELGAHLQNELAAHAVVFLKAGYEQTANTLSYVLYELALHPELQVRVR 347
                             |.|.   :.|:...|.:||.||||.|.:.||:..|.||.||:.|.::.
 Frog   307 VPQNQDRGQDPPRKSTQKTLN---EEEILGQAFIFLIAGYETTCSLLSFASYLLATHPDCQEKLL 368

  Fly   348 EEVKKAIERHDGHITHEGIKSLSFMGQVINETLRMHPITPYILRRTLNDYAVP--DHPKYILVKE 410
            :||.:..:.|: ...:..:..|.:|..||||||||:|......|....|..|.  ..|...:|: 
 Frog   369 KEVDEFSQEHE-EADYNTVHDLPYMEMVINETLRMYPPAYRFAREAARDCTVMGLGIPAGAVVE- 431

  Fly   411 LFLIIPTHAIHHDPDIYPDPEEFKPDRWSGPRDSLQEQGTWFGFGVGARSCIGIQFAQLQLRLAL 475
                ||...:.:||..:.:||:|.|:|::......:....:..||.|.|||||::.|.|:.::.|
 Frog   432 ----IPIGCLQNDPRFWHEPEKFNPERFTAEEKQKRHPFLFLPFGAGPRSCIGMRLALLEAKITL 492

  Fly   476 ALLLSEYEF-------------SLNTRKPLINLEDGI 499
            ..:|.::.|             ::.|.:|    :||:
 Frog   493 YRVLRKFRFQTCDLTQIPLQLSAMTTLRP----KDGV 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp317a1NP_001286435.1 p450 39..466 CDD:299894 126/476 (26%)
tbxas1XP_031753608.1 cytochrome_P450 71..526 CDD:425388 126/480 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.