DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a8 and CYP72C1

DIOPT Version :9

Sequence 1:NP_523749.2 Gene:Cyp6a8 / 36666 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:307 Identity:57/307 - (18%)
Similarity:108/307 - (35%) Gaps:73/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YFKRRGIPFVAPHLIRGNMEELQKTKNI-HEI--------------FQDHYNKFRESKAPFVGFF 77
            |.|::|....:..::.|:|.|..:...: |.:              |. |:...:..|..|.  :
plant    40 YLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLPLDADFLPRMMPFL-HHTVLKHGKKCFT--W 101

  Fly    78 FFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAH-------LFNLDGAQWRLLRNK 135
            :...|...|:|.|..::|:       |...:|...|   |.:|       |.|.:|.:|...|:.
plant   102 YGPYPNVIVMDPETLREIM-------SKHELFPKPK---IGSHNHVFLSGLLNHEGPKWSKHRSI 156

  Fly   136 LSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEI------RDLVARFTVDVIGTCAF-- 192
            |:..|....:|.:.|...|...|.:............:|:      .||    |.:::...:|  
plant   157 LNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKGTMELDSWTHCHDL----TRNMLARASFGD 217

  Fly   193 ----GIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVRTAPHIQEFYSRI 253
                ||:...::.|:.:......|::.......|...|.|...:..|.:              |.
plant   218 SYKDGIKIFEIQQEQIDLGLLAIRAVYIPGSKFLPTKFNRRLRETERDM--------------RA 268

  Fly   254 VTETVAVREKEHIKRNDFMDMLIE------LKNQKEMTLENGDVVRG 294
            :.:.:...::|.|||....|...:      |:.||..  :|.|.::|
plant   269 MFKAMIETKEEEIKRGRGTDKNSDCCSRCWLRIQKPS--KNKDQIQG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 54/296 (18%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.