DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a8 and CYP4F11

DIOPT Version :9

Sequence 1:NP_523749.2 Gene:Cyp6a8 / 36666 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:421 Identity:106/421 - (25%)
Similarity:204/421 - (48%) Gaps:50/421 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 IFYNEKDDPISAHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPK--- 169
            |||......:...|....|.:|...|..|:..|....:|    ..:.:.|:.:.:||:|..:   
Human   123 IFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILK----PYMKIFNKSVNIMHDKWQRLAS 183

  Fly   170 --NSVLEIRDLVARFTVDVIGTCAFGIQCNSLRDEKAEFL--YFGKRSLVDKRHGTLL--NGFMR 228
              ::.|::.:.::..|:|.:..|.|..:.| .:::.:|::  .....:.|:||:..:|  ..|:.
Human   184 EGSARLDMFEHISLMTLDSLQKCVFSFESN-CQEKPSEYIAAILELSAFVEKRNQQILLHTDFLY 247

  Fly   229 SYPKLARKLGMVRTAPH-IQEFYSRIVTETVA----------VREKEHIKRNDFMDMLIELKNQK 282
            ......::.   |.|.| :.:|...::.|...          ::.|...|..||:|:|:..|:  
Human   248 YLTPDGQRF---RRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFIDVLLLSKD-- 307

  Fly   283 EMTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQH 347
                |:|   :.|:.|::.|:|..|...|.:|::|.:.:.||.|||:|:.|::.|.||:|:::..
Human   308 ----EDG---KELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDR 365

  Fly   348 DQ-NFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIH 411
            :. ...::....|.:|...:.|:|||:..||.:.|...:.:|:|  ...||..|...:|....||
Human   366 EPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLP--DGRVIPKGIVCLINIIGIH 428

  Fly   412 HDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFST 476
            ::|:::|:|..:.|.||..|....|..:|::||..|||||||..|...:.::.|||.:.:|:.. 
Human   429 YNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRIL- 492

  Fly   477 CSKTPNPLVYDPK---SFVLGVKDGIYLKVE 504
                  |...:|:   ..:|..:.|::|:||
Human   493 ------PTHTEPRRKPELILRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 104/418 (25%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 101/408 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.