DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a8 and Cyp311a1

DIOPT Version :9

Sequence 1:NP_523749.2 Gene:Cyp6a8 / 36666 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster


Alignment Length:394 Identity:100/394 - (25%)
Similarity:176/394 - (44%) Gaps:44/394 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTC 190
            ||.|...|..|:..|....::...|.:.......  |......:.:.||:.:.:....:|.|...
  Fly   116 GAHWTRQRRLLTPAFQPQLLRSFAPAIGGHVERL--VGRLGATRGAFLEVTEPLFACLLDAIVDT 178

  Fly   191 AFGIQCNSLRDEKAEFL---YFGKRSLVDKRHGTLLNG---FMRSYPKLARKLGMVRTAPHIQEF 249
            :.|.|.::...:.:..:   :...:.|..:....||:.   |.|:  :|.|.|.     ..:|..
  Fly   179 SMGAQLDTQSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWIFQRT--QLWRDLD-----EQLQVI 236

  Fly   250 YSRIVTETVAVREKEHI-------KRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVF 307
            :|: :...:..|.||.:       :.::.:|.|:..|.:.:          .|:..|:..:...|
  Fly   237 HSQ-MESVIEKRAKELLDMGEPAGRAHNLLDTLLLAKFEGQ----------SLSRREIRDEINTF 290

  Fly   308 FIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLRL 372
            ..||.:|:::.|.|.||.|||.|:.|.::|.|:::|  ..|:....:....|.||..::.|.|||
  Fly   291 VFAGVDTTTAAMSFVLYALAKFPETQTRLRKELQDV--ALDETTDLDALNGLPYLEALIKEVLRL 353

  Fly   373 YTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESA-GR 436
            |||||...|...:...:.|.   ...||.::.|....:.||...||:|:.|:|||:.||:.| ..
  Fly   354 YTIVPTTGRQTTQSTEIGGR---TYCAGVTLWINMYGLAHDKEYYPDPYAFKPERWLPEDGAVAP 415

  Fly   437 PSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGI-- 499
            |:.:::||..||..|||.|:..:..::..|.|:|.|:.. .|....||..:.: .||..:.||  
  Fly   416 PAFSYIPFSGGPHVCIGRRYSLLLMKLLTARLVREFQME-LSPEQAPLRLEAQ-MVLKAQQGINV 478

  Fly   500 -YLK 502
             :||
  Fly   479 SFLK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 100/394 (25%)
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 98/390 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.