DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a8 and Cyp4d2

DIOPT Version :9

Sequence 1:NP_523749.2 Gene:Cyp6a8 / 36666 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster


Alignment Length:560 Identity:120/560 - (21%)
Similarity:226/560 - (40%) Gaps:135/560 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILFQVAVALLAILTYYIHRKLTYFKRRG---------IPFVAPHLIRGNMEELQKTKNIHEIFQD 61
            :|..||.|.|.:..:       .::|||         :||:...|:...::.        |...|
  Fly     7 VLLLVAFATLLLWDF-------LWRRRGNGILPGPRPLPFLGNLLMYRGLDP--------EQIMD 56

  Fly    62 HYNKFRESKAPFVGFFFFQSPAAFVID-----------LELAKQILIKDFSNFSNKGIFYNEKDD 115
            ...|.:.........:.....|.|..|           ..:.|..|.|..:.:...|:..:    
  Fly    57 FVKKNQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMS---- 117

  Fly   116 PISAHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPT--------VVSVANEFMTVMHEKVPKN-- 170
                     .|.:|.            |:.|::.||        .|.:.::...||.|::...  
  Fly   118 ---------TGRKWH------------GRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRAD 161

  Fly   171 --SVLEIRDLVARFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKL 233
              :.:.|..::....:|:|...|.|.:.|:.::....::     ..|:.....|:..|:.::.::
  Fly   162 GMTPINIFPVICLTALDIIAETAMGTKINAQKNPNLPYV-----QAVNDVTNILIKRFIHAWQRV 221

  Fly   234 ARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIK-RNDFMDMLIE------LKNQKEMTLENG-- 289
                          ::..|:...|.|.|:.:.|| .:||.:.:|.      :.|.||.|.|..  
  Fly   222 --------------DWIFRLTQPTEAKRQDKAIKVMHDFTENIIRERRETLVNNSKETTPEEEVN 272

  Fly   290 -----------DVVRGLTM-------EEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKV 336
                       ||:...|:       |::..:...|...|.:|::|.:.|.|||::::|::|.::
  Fly   273 FLGQKRRMALLDVLLQSTIDGAPLSDEDIREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRL 337

  Fly   337 RAEVEEVI-EQHDQNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPG-HPNFVIEA 399
            :.|:.:|: |......|.....:||::..|:.|:|||:..||.:.|..|:...:.| |    |.|
  Fly   338 QQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDVEIRGKH----IPA 398

  Fly   400 GQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIG 464
            |.:..:....:..||..:..|.|||||||..:.....| .|::||..|||||||.:|..::.:..
  Fly   399 GTNFTMGIFVLLRDPEYFESPDEFRPERFDADVPQIHP-YAYIPFSAGPRNCIGQKFAMLEMKST 462

  Fly   465 LALLIRNFKFSTCSKTPNPLVYDPK---SFVLGVKDGIYL 501
            ::.|:|:|:..       ||..:|:   :.||...:|::|
  Fly   463 VSKLLRHFELL-------PLGPEPRHSMNIVLRSANGVHL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 110/518 (21%)
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 111/526 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.