DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a8 and CYP4A11

DIOPT Version :9

Sequence 1:NP_523749.2 Gene:Cyp6a8 / 36666 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:547 Identity:133/547 - (24%)
Similarity:230/547 - (42%) Gaps:108/547 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFQVAVALLAIL------TYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNK 65
            :.|.|..|:.:|      ..|:||:......:..|....|.:.|:::|||:.:.:..| |.....
Human    18 ILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRI-QKWVET 81

  Fly    66 FRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDP------------IS 118
            | .|..|.  :.:.......:.|.:..|.||               .:.||            |.
Human    82 F-PSACPH--WLWGGKVRVQLYDPDYMKVIL---------------GRSDPKSHGSYRFLAPWIG 128

  Fly   119 AHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVM---HEKVPKNSVLEIRDLVA 180
            ..|..|:|..|...|..|:..|   ...::.|.|..:|:....::   .|.:.::|.||:...|:
Human   129 YGLLLLNGQTWFQHRRMLTPAF---HYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVS 190

  Fly   181 RFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVRTAPH 245
            ..|:|.|..|||..| .|::.::....|.  :::.|      ||..:.|         .||.|.|
Human   191 LMTLDTIMKCAFSHQ-GSIQVDRNSQSYI--QAISD------LNNLVFS---------RVRNAFH 237

  Fly   246 IQE-FYS----------------RIVTETVAVR--------EKEHIKRN---DFMDMLIELKNQK 282
            ..: .||                :...:.:.:|        |.|.|||.   ||:|:|:..|   
Human   238 QNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAK--- 299

  Fly   283 EMTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQH 347
               :|||.:   |:.:::.|:...|...|.:|::|.:.:.||.||.:|..|::.|.|:..::.. 
Human   300 ---MENGSI---LSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGD- 357

  Fly   348 DQNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHH 412
            ..:.|:.....:.|....:.|.||||..||.:.|..:.....|...:  :..|..|::....:||
Human   358 GASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRS--LPKGIMVLLSIYGLHH 420

  Fly   413 DPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFK-FST 476
            :|.::|.|..|.|.||:|  .:.:.|.|:|||..|.|||||.:|...:.::..||.:..|: ...
Human   421 NPKVWPNPEVFDPFRFAP--GSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPD 483

  Fly   477 CSKTPNPLVYDPKSFVLGVKDGIYLKV 503
            .::.|.|:.    ..||..|:||:|::
Human   484 PTRIPIPIA----RLVLKSKNGIHLRL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 125/507 (25%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 125/510 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.