DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP4F2

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:555 Identity:139/555 - (25%)
Similarity:235/555 - (42%) Gaps:121/555 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLALVG--YLL---MKW---------------RSTMRHW----QDLGIPCEEPHILMGSMKGVRT 51
            ||.|||  :||   :.|               :...|:|    |.:..|.||         |:|.
Human    21 LLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPTEE---------GMRV 76

  Fly    52 ARSFNEIWTSYYNKFR-GSGPFAGFYWFRRPAVF--VLETSLAKQILIKEFNKFTDRGFFHNPED 113
               ..::..:|...|: ..||.:.......|.:.  |:..|.|  |..|:       .||::..:
Human    77 ---LTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAA--IAPKD-------KFFYSFLE 129

  Fly   114 DPLSGQLFLLDGQKWRTMRNKLSSTFTSGKMK-YMFPTVVKVANEFTDVF---GQNVAK--SPVV 172
            ..|...|.|..|.||...|..|:..|....:| ||     |:.||..::.   .|.:|.  |..:
Human   130 PWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYM-----KIFNESVNIMHAKWQLLASEGSACL 189

  Fly   173 EVRELLARFTTDVIGTCAFGIECSSLKDPD---AEFREMGRRSLTEQR-------------LGPV 221
            ::.|.::..|.|.:..|.|..:....:.|.   |...|:.  :|..:|             |.|.
Human   190 DMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELS--ALVSKRHHEILLHIDFLYYLTPD 252

  Fly   222 GIGFVNSFPNLARRLHMKMTAEPIERFFMRIVRETVAFREQNNIRRNDFMDQLID------LKNK 280
            |    ..|....|.:|         .|...:::|          ||.....|.:|      .|:|
Human   253 G----QRFRRACRLVH---------DFTDAVIQE----------RRRTLPSQGVDDFLQAKAKSK 294

  Fly   281 P------LMVSQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQ 339
            .      |::|:..:...|:.|:|.|:|..|...|.:|:::.:.:.||.||::.:.|.|.|:|.|
Human   295 TLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQ 359

  Fly   340 EVI-EKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMPVL 402
            |:: ::...|:.::.:..|.:|...:.|:|||:..:||::|...:|..:| |.   ||.||:..|
Human   360 ELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGR---VIPKGIICL 421

  Fly   403 IPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLI 467
            |.....|.:..::.:|..::|..|.||.:|||..:.::||..|||||||..|...:.::.|||.:
Human   422 ISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTL 486

  Fly   468 KDFKFSVCEKTTIPMTYNKEMFLIASNSGIYLKAE 502
              .:|.|....|.|.  .|...::.:..|::|:.|
Human   487 --LRFRVLPDHTEPR--RKPELVLRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 126/502 (25%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 8/35 (23%)
p450 52..515 CDD:365848 129/520 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.