DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP97A3

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:513 Identity:119/513 - (23%)
Similarity:227/513 - (44%) Gaps:80/513 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTALLALVGYLLMK--WRSTMRH-WQDLGIPC--------------EEPHI--LMGSMKGVRTAR 53
            |:|.:|...:.:.|  :.||::: ...:|||.              :.|.:  ..||::.||...
plant    63 LSARIASGAFTVRKSSFPSTVKNGLSKIGIPSNVLDFMFDWTGSDQDYPKVPEAKGSIQAVRNEA 127

  Fly    54 SF---NEIWTSYYNKFRGS-GPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDD 114
            .|   .|::.:|...||.: ||        :..:.|.:.|:||.|| |:..|...:|......|.
plant   128 FFIPLYELFLTYGGIFRLTFGP--------KSFLIVSDPSIAKHIL-KDNAKAYSKGILAEILDF 183

  Fly   115 PLSGQLFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNV----AKSPVVEVR 175
            .:...|...||:.||..|..:....   ..||: ..::.:..|.:|...|.:    .|...||:.
plant   184 VMGKGLIPADGEIWRRRRRAIVPAL---HQKYV-AAMISLFGEASDRLCQKLDAAALKGEEVEME 244

  Fly   176 ELLARFTTDVIGTCAFGIECSSLKDP----DAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRL 236
            .|.:|.|.|:||...|..:..||.:.    :|.:..:  |...::.:.|:.:..:..:.:::.|.
plant   245 SLFSRLTLDIIGKAVFNYDFDSLTNDTGVIEAVYTVL--REAEDRSVSPIPVWDIPIWKDISPRQ 307

  Fly   237 HMKMTAEPIERFFMRIVRETV--------AFREQNNIRRNDFMDQLIDLKNKPLM--VSQSGESV 291
            ....|:       ::::.:|:        ...|:..::   |.::.::.::..::  :..||:.|
plant   308 RKVATS-------LKLINDTLDDLIATCKRMVEEEELQ---FHEEYMNERDPSILHFLLASGDDV 362

  Fly   292 NLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGEL--NYESM 354
              :.:::.........||.|||:..:.:..|.|.....:..::::|...||    |:.  ..:.|
plant   363 --SSKQLRDDLMTMLIAGHETSAAVLTWTFYLLTTEPSVVAKLQEEVDSVI----GDRFPTIQDM 421

  Fly   355 KDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPN 419
            |.|.|..:|::|:||||...|||.|..: |.::.|  :|.||:|..:.|....:||....:.:..
plant   422 KKLKYTTRVMNESLRLYPQPPVLIRRSI-DNDILG--EYPIKRGEDIFISVWNLHRSPLHWDDAE 483

  Fly   420 TFNPDNF---SPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSV 474
            .|||:.:   .|...:...:..:||||.|||.|||..|...:..:.:|:||:.|.|.:
plant   484 KFNPERWPLDGPNPNETNQNFSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQI 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 111/483 (23%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 119/513 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.