DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP709B3

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 / 828885 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana


Alignment Length:530 Identity:125/530 - (23%)
Similarity:230/530 - (43%) Gaps:101/530 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VGTV-LLTALLALVGYLLMK-WRS----------TMRHWQDLGIPCEEPHILMGSMKGVRTARS- 54
            :.|: |||.:|.|  :::.| |::          ..:.::..||...:..||.|::..::..:. 
plant     4 ISTINLLTIVLLL--FVVSKIWKACWILLLRPLMLSKRFKKQGISGPKYKILYGNLSEIKKMKKE 66

  Fly    55 -------------FNEIWTSYYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRG 106
                         |..::..|:......|....|:...:|.:::....||||:|..:|      |
plant    67 ADLCVLDPNSNDIFPRVFPQYHQWMSQYGDTFLFWTGTKPTIYISNHELAKQVLSSKF------G 125

  Fly   107 F----FHNPEDDPLSGQ-LFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTV----VKVANEFTDV- 161
            |    ...||...|.|: |..:.|..|...|..|:..|:..::|.|...:    :::..|:... 
plant   126 FTIIPVKRPEVFILFGKGLSFIQGDDWIRHRRILNPAFSMDRLKAMTQPMGDCTLRIFEEWRKQR 190

  Fly   162 -FGQNVAKSPVVEVRELLARFTTDVIGTCAF------GIE-CSSLKDPDAEFREMGRRSLTEQRL 218
             .|:.:.|   :|:.:...:.|.|:|.|.||      ||| |.|    ..|..:....|||...:
plant   191 RNGEVLIK---IEISKEFHKLTADIIATTAFGSSYAEGIELCRS----QTELEKYYISSLTNVFI 248

  Fly   219 GPVGIGFVNSFPNLAR-RLHMKMTAEPIERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPL 282
              .|..::.:..||.. .||.|     ::....||:..    |.::..:...:.|.|:.:.   |
plant   249 --PGTQYLPTPTNLKLWELHKK-----VKNSIKRIIDS----RLKSKCKTYGYGDDLLGVM---L 299

  Fly   283 MVSQSGE-SVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCN 346
            ..::|.| ...:.::||..:...|:.||..|:|..:.:....|:.:|..|.::|   :||..:|.
plant   300 TAAKSNEYERKMRMDEIIEECKNFYYAGQGTTSILLTWTTMLLSLHQGWQEKLR---EEVFNECG 361

  Fly   347 GEL--NYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMH 409
            .:.  :.::...|..::.|:.|:||||..:..::||..:|.:| ||.:  |.||..::||...||
plant   362 KDKIPDTDTFSKLKLMNMVLMESLRLYGPVIKISREATQDMKV-GHLE--IPKGTSIIIPLLKMH 423

  Fly   410 RDEKLYA-NPNTFNPDNFS---------PERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLA 464
            ||:.::. :...|||..|.         |..:        |||..|||.||...|..::|:..|.
plant   424 RDKAIWGEDAEQFNPLRFENGISQATIHPNAL--------LPFSIGPRACIAKNFAMVEAKTVLT 480

  Fly   465 LLIKDFKFSV 474
            ::::.|:.|:
plant   481 MILQQFQLSL 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 115/486 (24%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 124/525 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.