DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP705A9

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_180269.1 Gene:CYP705A9 / 817243 AraportID:AT2G27010 Length:498 Species:Arabidopsis thaliana


Alignment Length:493 Identity:100/493 - (20%)
Similarity:188/493 - (38%) Gaps:71/493 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLTALLALVGYLLMKWRSTMRHWQD-LGIPCEEPHI-LMGSMKGVRTA---RSFNEIWTSYYNKF 66
            |:..||.|:.:|...:  ..:..:| ..:|...|.: ::|.:..:.:.   ||..::.:.|    
plant     9 LILILLCLLSFLCYSF--FFKKPKDGFNLPPSPPSLPIIGHLHHLLSLFMHRSLQKLSSKY---- 67

  Fly    67 RGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQKWRTM 131
               ||....:.|..|.:.|...|:|.:|...:....:.|.|..| |...|.|....         
plant    68 ---GPLLYLHVFNVPILLVSSPSIAYEIFRTQDVNVSSRDFPTN-EGSLLFGSFGF--------- 119

  Fly   132 RNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGTCAFGIECS 196
                 .|..|..:|:.......|...:.........|...||:.|...:...:.:.....|..||
plant   120 -----GTAPSSGLKHSRGHKKSVQRSYYLNLLDKAVKKESVEIAEEAMKLVNNTVCQMIMGRSCS 179

  Fly   197 S-----------LKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHMKMTAEPIERFFM 250
            .           :...||..::.....:..:.|..:||.           |..|...:...:|..
plant   180 EENGEAERVRGLVTKTDALTKKFILAGILRKPLQKIGIS-----------LFKKELMDASCKFNE 233

  Fly   251 RIVRETVAFRE--QNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGFETS 313
            .:.:..|.::|  :.:.:..|.||:|::      :.........:|.:.|.:.....|.||.:|.
plant   234 VLEKILVEYKEKVEEHHQGTDMMDKLLE------VYGDEKAEYKITRDHIKSLFVDLFFAGTDTW 292

  Fly   314 STTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLN 378
            :..:.:.:.|:..|..|..|:|:|...|:.|.. .:....:.:|..|...|.|.|||:..:|::.
plant   293 THAIQWIMAEIINNSYILERLREEIDSVVGKTR-LIQETDLPNLPCLQATVKEGLRLHPPVPLVL 356

  Fly   379 RECLEDYEVPGHPKYVIKKGMPVLIPCG-AMHRDEKLYANPNTFNPDNF-SPERVKERDSV---- 437
            |...|...:.|.  ||.:|  ..|:..| ||.||.:.:.:|..|.|:.| :..|..:.|.:    
plant   357 RTFKEGCTIGGF--YVPEK--TTLVVNGYAMMRDPEYWEDPQEFKPERFLASSRSSQNDEIRDEL 417

  Fly   438 -EWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSV 474
             ::||||:|.|.|.|.....:.....:.::::.|.:.:
plant   418 LKYLPFGNGRRACPGANLAYISVGTAIGVMVQCFDWEI 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 94/464 (20%)
CYP705A9NP_180269.1 p450 46..486 CDD:299894 92/454 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.