DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP705A8

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_180268.1 Gene:CYP705A8 / 817242 AraportID:AT2G27000 Length:514 Species:Arabidopsis thaliana


Alignment Length:483 Identity:103/483 - (21%)
Similarity:197/483 - (40%) Gaps:84/483 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RSFNEIWTSYYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLS 117
            ||..::.:.|       ||....:.|..|.:.|...|:|.:|...:....:.|.|..|      .
plant    62 RSLQKLSSKY-------GPLLYLHVFNVPILLVSSPSIAYEIFRAQDVNVSTRDFPTN------E 113

  Fly   118 GQLFLLD--------GQKWRTMRNKLSSTFTSGKMKYMFPTVVK-----VANEFTDVFGQNV--- 166
            |.|||..        |:.|:.|: ||..|      |.:.|..::     .||| .:.|..|:   
plant   114 GSLFLGSFSFITAPYGEYWKFMK-KLIVT------KLLGPQALERSQRIRANE-VERFYSNLLDK 170

  Fly   167 -AKSPVVEVRELLARFTTDVIGTCAFGIECSS-----------LKDPDAEFREMGRRSLTEQRLG 219
             .|...||:.:...:...::|.....|..||.           :...||..::....::..:.|.
plant   171 AMKKESVEIADEAMKLVNNIICKMIMGRTCSEENGEAERIRGLVTKSDALLKKFLLAAILRKPLK 235

  Fly   220 PVGIGFVNSFPNLARRLHMKMTAEPIERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMV 284
            .:||       .|.:::.|.::.: .:....:|:.|.....|:|. :..|.||:|::      :.
plant   236 KIGI-------TLFKKVFMDISLK-FDEVLEKILVENEERLEENQ-QGTDIMDKLLE------VY 285

  Fly   285 SQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGEL 349
            ........:|.:.|.:.....|.||.:|::.|:.:.:.|:..|..|..|:|:|...|:.|.. .:
plant   286 GDKTSEYKITRDHIKSLFVDLFFAGTDTATHTIEWTMAEIMNNSLILERLREEIDSVVGKTR-LI 349

  Fly   350 NYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKL 414
            ....:.:|:||...|.|.|||:..:|::.|...:...:.|   :.|.|...:::...|:.||...
plant   350 QETDLPNLLYLQATVKEGLRLHPTIPLVLRTFQDGCTIGG---FSIPKKTKLVVNGYAIMRDPDN 411

  Fly   415 YANPNTFNPDNF-SPERVKERDSV-----EWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKF- 472
            :.:|..|.|:.| :..|..::|::     ::|.||.|.|.|.|:....:.....:.::::.|.: 
plant   412 WEDPLEFKPERFLASSRSSQKDAIKEEVLKYLSFGSGRRGCPGVNLAYVSVETAIGVMVQCFDWK 476

  Fly   473 ---------SVCEKTTIPMTYNKEMFLI 491
                     .|..|.|:.|.:..:..|:
plant   477 IDGHKINMNEVAGKGTLSMAHPLKCTLV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 103/483 (21%)
CYP705A8NP_180268.1 p450 55..506 CDD:299894 103/483 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.