DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp3a71-ps

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_008767252.2 Gene:Cyp3a71-ps / 690383 RGDID:1597309 Length:183 Species:Rattus norvegicus


Alignment Length:94 Identity:30/94 - (31%)
Similarity:45/94 - (47%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 FTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGTCAFGIECSSLKDPDA 203
            |||||:|.|||.:....:.......|...|...|.|:::...::.|||.:.:||:...||.:|..
  Rat     2 FTSGKLKVMFPIIKLYGDILVKYLRQEAEKGKPVSVKDIFGAYSMDVITSTSFGVNVDSLNNPKD 66

  Fly   204 EFREMGRRSLTEQRLGPVGIGFVNSFPNL 232
            .|.|..::.|......|:.|. |..||.|
  Rat    67 PFVEKTKKFLRLDYFDPLFIS-VELFPFL 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 30/94 (32%)
Cyp3a71-psXP_008767252.2 cytochrome_P450 2..>153 CDD:425388 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.