DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP4F12

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:541 Identity:134/541 - (24%)
Similarity:235/541 - (43%) Gaps:90/541 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VGTVLLTALLALVGYLLMKWRSTMRH-----------------WQDLGI--PCEEPHILMGSMKG 48
            ||:.||..:||        |.....:                 |..||:  |.||     |....
Human    26 VGSWLLARILA--------WTYAFYNNCRRLQCFPQPPKRNWFWGHLGLITPTEE-----GLKNS 77

  Fly    49 VRTARSFNEIWTSYYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKE--FNKFTDRGFFHNP 111
            .:.:.::::.:|.:.      ||...|.....|......|:.:..|..|:  |.:|.        
Human    78 TQMSATYSQGFTVWL------GPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFL-------- 128

  Fly   112 EDDPLSGQLFLLD-GQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAK--SPVVE 173
              .|..|:..||. |.||...|..|:..|....:|.......|.||...|.: |::|.  |..::
Human   129 --KPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKW-QHLASEGSSRLD 190

  Fly   174 VRELLARFTTDVIGTCAFGIECSSLKDPD---AEFREMGRRSLTEQRLGPV--GIGFVNSFPNLA 233
            :.|.::..|.|.:..|.|..:....:.|.   |...|:.  :|.|:|...:  .:.|:....:..
Human   191 MFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELS--ALVEKRSQHILQHMDFLYYLSHDG 253

  Fly   234 RRLHMKMTAEPIERFFMRIVRE---TVA-------FREQNNIRRNDFMDQLIDLKNKPLMVSQSG 288
            ||.|  .....:..|...::||   |:.       |:::...:..||:|        .|::|:..
Human   254 RRFH--RACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFID--------VLLLSKDE 308

  Fly   289 ESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVI-EKCNGELNYE 352
            :...|:.|:|.|:|..|...|.:|:::.:.:.||.||::.:.|.|.|:|.||:: ::...|:.::
Human   309 DGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWD 373

  Fly   353 SMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMPVLIPCGAMHRDEKLYA 416
            .:..|.:|...|.|:|||:...|.::|.|.:|..:| |.   ||.||:..||....:|.:..::.
Human   374 DLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGR---VIPKGITCLIDIIGVHHNPTVWP 435

  Fly   417 NPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIP 481
            :|..::|..|.||..|.|..:.::||..|||||||..|...:.::.|||::..|:|  ....|.|
Human   436 DPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRF--LPDHTEP 498

  Fly   482 MTYNKEMFLIASNSGIYLKAE 502
            .  .|...::.:..|::|:.|
Human   499 R--RKLELIMRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 122/485 (25%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 124/494 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.