DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4f14

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001191262.1 Gene:Cyp4f14 / 64385 MGIID:1927669 Length:524 Species:Mus musculus


Alignment Length:545 Identity:123/545 - (22%)
Similarity:239/545 - (43%) Gaps:95/545 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVLLTALLALVGYLLMKWRSTMRHWQDL-GIPCEEP--HILMGSMKGVR-TARSFNEIWTSYYNK 65
            |:||.....::..:|::..:..|:::.| |.| :.|  :.|||.:..|. |.:...|:     .:
Mouse    21 TLLLLGASWILARILIQIYAAYRNYRHLHGFP-QPPKRNWLMGHVGMVTPTEQGLKEL-----TR 79

  Fly    66 FRGSGPFAGFYWF--RRPAVFVLETSLAKQIL-------IKEFNKFTDRGFFHNPEDDPLSGQLF 121
            ..|:.|.....|.  ..|.:.:..:.:.:.||       :|:.       .|::.....|...|.
Mouse    80 LVGTYPQGFLMWIGPMVPVITLCHSDIVRSILNASAAVALKDV-------IFYSILKPWLGDGLL 137

  Fly   122 LLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAK-----SPVVEVRELLARF 181
            :..|.||...|..|:..|....:|    ..||:.|:.|::......:     |..:::.|.::..
Mouse   138 VSAGDKWSRHRRMLTPAFHFNILK----PYVKIFNDSTNIMHAKWQRLISDGSARLDMFEHVSLM 198

  Fly   182 TTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHMKMTAEPIE 246
            |.|.:..|.|..: |:.::..:|:                 |..:.....|..:.|.    :|: 
Mouse   199 TLDSLQKCVFSFD-SNCQEKSSEY-----------------IAAILELSALVAKRHQ----QPL- 240

  Fly   247 RFFM----RIVRETVAFREQNNI-----------RRNDFMDQLID--LKNKP----------LMV 284
             .||    .:..:.:.||:..|:           |.....||.:|  ||:|.          |::
Mouse   241 -MFMDLLYNLTPDGMRFRKACNVVHEFTDAVIRERHRTLPDQGLDDFLKSKAKSKTLDFIDVLLL 304

  Fly   285 SQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIE-KCNGE 348
            |:..:...|:.|:|.|:|..|...|.:|:::.:.:.||.||::.:.|.|.|:|.||::. :...|
Mouse   305 SKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVQELLRGREPEE 369

  Fly   349 LNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMPVLIPCGAMHRDE 412
            :.::.:..|.:|...:.|:|||:..:.|::|.|.:|..:| |.   .|.||:..||....:|.:.
Mouse   370 IEWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGR---TIPKGIICLISIFGIHHNP 431

  Fly   413 KLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEK 477
            .::.:|..::|..|.||.:|:...:.::||..|||||||..|...:.::.|||.:..|:....:|
Mouse   432 SVWPDPEVYDPFRFDPENIKDSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRLLPDDK 496

  Fly   478 TTIPMTYNKEMFLIASNSGIYLKAE 502
            .    ...:...::.:..|::|:.|
Mouse   497 E----PRRQPELILRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 114/509 (22%)
Cyp4f14NP_001191262.1 p450 52..511 CDD:365848 113/506 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.