DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp3a25

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_062766.2 Gene:Cyp3a25 / 56388 MGIID:1930638 Length:503 Species:Mus musculus


Alignment Length:506 Identity:142/506 - (28%)
Similarity:263/506 - (51%) Gaps:51/506 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVGT--VLLTALLALVGYLLMKWRSTMRH--WQDLGIPCEEPHILMGSMKGVRTARSFNEIWTS 61
            :|:.|  :|:|:|:....|      .|..|  ::.||||..:|..|:|::     ...::.:|..
Mouse     7 LSIETWVLLVTSLVLFYIY------GTYSHGLFKKLGIPGPKPLPLLGTI-----FNYYDGMWKF 60

  Fly    62 YYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKE-FNKFTDRGFFHNPEDDP---LSGQLFL 122
            ..:.::..|...|||...:|.:.:::..:.|.:|:|| ::.||:|.||     .|   :...:.:
Mouse    61 DEDCYKKYGKIWGFYEGPQPILAIMDPEIIKIVLVKECYSVFTNRRFF-----GPVGFMKKAITI 120

  Fly   123 LDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNV----AKSPVVEVRELLARFTT 183
            .:.::|:.:|..||.||||||:|.|||    :..::.|:..:|:    .|...:.::::...::.
Mouse   121 SEDEEWKRLRTLLSPTFTSGKLKEMFP----IMRQYGDILVRNLRREEEKGEPISMKDIFGAYSM 181

  Fly   184 DVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHM-------KMT 241
            |||...:||:...||.:|...|.:..::.|..:...|..:..: .||.|.....|       :.:
Mouse   182 DVITGTSFGVNVDSLNNPQDPFVQKAKKILKFKIFDPFLLSII-LFPFLTPIYEMLNFSIFPRDS 245

  Fly   242 AEPIERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAFVFF 306
            ....::|..|:.:|.:|..::|.:   ||:..:::.:|.....||..    |:..|:||||.:|.
Mouse   246 MNFFKKFVKRMKKERLASNQKNRV---DFLQLMMNTQNSKGQESQKA----LSDLEMAAQAVIFI 303

  Fly   307 AAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLRLY 371
            ..|::.:||::...:||||.:.|:|.:::.|....:.. ...:.|:::.|:.|||.||:|:||||
Mouse   304 FGGYDATSTSISLIMYELATHPDVQKKLQDEIDRTLPN-KAPVTYDALMDMEYLDMVVNESLRLY 367

  Fly   372 TVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDS 436
            .:...|.|...:|.|:.|   ..|.||..|:||...:||:.:.:..|..|.|:.||.|.....|.
Mouse   368 PIAIRLERVSKKDVEING---VFIPKGTVVMIPIYPLHRNPEYWPEPQEFCPERFSKENKGNIDP 429

  Fly   437 VEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKE 487
            ..::|||:||||||||||..:..::.:..::::|....||:|.||:..::|
Mouse   430 YIYMPFGNGPRNCIGMRFALISIKLAVIGVLQNFTVQPCEETQIPLKISRE 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 131/468 (28%)
Cyp3a25NP_062766.2 p450 39..493 CDD:278495 131/468 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.