DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4d14

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster


Alignment Length:425 Identity:89/425 - (20%)
Similarity:175/425 - (41%) Gaps:81/425 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LSGQLFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAK-----------S 169
            |...|.:..|:||...|..::..|.           .|:..:|.:||.|..|.           .
  Fly   115 LGDGLLISQGKKWFRRRKIITPAFH-----------FKILEDFVEVFDQQSATMVQKLYDRADGK 168

  Fly   170 PVVEVRELLARFTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLAR 234
            .|:.:..:......|:|...|.|::.::...|...:         .|.:..........|.|..:
  Fly   169 TVINMFPVACLCAMDIIAETAMGVKINAQLQPQFTY---------VQSVTTASAMLAERFMNPLQ 224

  Fly   235 RLHMKMTAEPIERFFMRIVRETVAFREQNNIRRN--DFMDQLIDLKNKPLM--VSQSGES----- 290
            ||...|     :.|:.:::.:.      |:..:|  ||.:.:|..:.:.|.  ::..|::     
  Fly   225 RLDFTM-----KLFYPKLLDKL------NDAVKNMHDFTNSVITERRELLQKAIADGGDADAALL 278

  Fly   291 ----------------------VNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNR 333
                                  ..|:.::|..:...|...|.:|:::::.|..|.||::.::|.|
  Fly   279 NDVGQKRRMALLDVLLKSTIDGAPLSNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQAR 343

  Fly   334 VRKECQEVI-EKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKK 397
            |.:|.::|| :..:..:..:.:.:|.||:.|:.|:|||:..:|::.|...:|..:.|.   :|..
  Fly   344 VFQEVRDVIGDDKSAPVTMKLLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGK---LIPA 405

  Fly   398 GMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIG 462
            ...|:|......||...:.:|..|.||.||.||..|.....:.||..|||||||.:|..::.:..
  Fly   406 DSNVIILIYHAQRDPDYFPDPEKFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKST 470

  Fly   463 LALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGI 497
            ::.:::.|:.....:...|:.    ..::.|.:||
  Fly   471 ISKMVRHFELLPLGEEVQPVL----NVILRSTTGI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 89/425 (21%)
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 85/407 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.