DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4e1

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster


Alignment Length:447 Identity:89/447 - (19%)
Similarity:187/447 - (41%) Gaps:88/447 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WTSYYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSG-QLFL 122
            |..||:....:.|            ..:|..|:.|.||.:.:.:   ...|     |..| .|..
  Fly    74 WIGYYSNIMVTNP------------KYMEFILSSQTLISKSDVY---DLTH-----PWLGLGLLT 118

  Fly   123 LDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAK-----------SPVVEVRE 176
            ..|.||...|..::..|.           ..:..:|.:|..:|..|           ..:.:.:|
  Fly   119 STGSKWHKHRKMITPAFH-----------FNILQDFHEVMNENSTKFIDQLKKVADGGNIFDFQE 172

  Fly   177 LLARFTTDVIGTCAFGIECSSLKDPDAE----FRE----MGRRSLTEQRLGPVGIGFVNSFPNLA 233
            .....|.|||...|.|:..:::::..:.    |::    :..|:.:..:.......|...:|..:
  Fly   173 EAHYLTLDVICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYS 237

  Fly   234 RRLHMKMTAEPIERFFMRIVRETVAFREQN---NIRRND-------FMDQLIDLK--NKPLMVSQ 286
            :      |.:.::.|...|:.:.:..|:..   .|:.::       |:|.|:..|  .:|     
  Fly   238 K------TLKTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLLSSKVDGRP----- 291

  Fly   287 SGESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVI--EKCNGEL 349
                  ||.:|:..:...|...|.:|:::.:|||:|.|:::.|.|.::..|..:|:  .....:.
  Fly   292 ------LTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDA 350

  Fly   350 NYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKL 414
            .::.:..:.:||..:.|..|||..:|.:.|...:||.:.|.   ::.||..:.:....:..::::
  Fly   351 TFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVIDGD---IVPKGTTLNLGLLMLGYNDRV 412

  Fly   415 YANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFK 471
            :.:|:.|.|:.|..|:   ....|::||..|||||||.:|..::.:..::.:|::|:
  Fly   413 FKDPHKFQPERFDREK---PGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFE 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 89/447 (20%)
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 89/447 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.