DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP4F3

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:561 Identity:134/561 - (23%)
Similarity:232/561 - (41%) Gaps:133/561 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLALVG--YLL---MKWRSTM---------------RHW--QDLGI--PCEEPHILMGSMKGVRT 51
            ||.|||  :||   :.|..|.               |:|  ..||:  ..||..:...|:     
Human    21 LLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSL----- 80

  Fly    52 ARSFNEI---WTSYYNKFRGSGPFAGFYW----------FRRPAVFVLETSLAKQILIKEFNKFT 103
            |.:|.::   |.         ||     |          :.:|.:|.....:.|..:...|.|  
Human    81 ACTFGDMCCWWV---------GP-----WHAIVRIFHPTYIKPVLFAPAAIVPKDKVFYSFLK-- 129

  Fly   104 DRGFFHNPEDDPLSGQ-LFLLDGQKWRTMRNKLSSTFTSGKMK-YMFPTVVKVANEFTDVF---G 163
                       |..|. |.|..|:||...|..|:..|....:| ||     |:.||..::.   .
Human   130 -----------PWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYM-----KIFNESVNIMHAKW 178

  Fly   164 QNVAK--SPVVEVRELLARFTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFV 226
            |.:|.  |..:::.|.::..|.|.:..|.|..: |..::..:|:                 |..:
Human   179 QLLASEGSARLDMFEHISLMTLDSLQKCVFSFD-SHCQEKPSEY-----------------IAAI 225

  Fly   227 NSFPNLARRLHMKMT--------AEPIERFFMRIVR-----ETVAFREQNNIRRNDFMDQLIDLK 278
            .....|..:.|.::.        ..|..:.|.|..|     .....:|:.....:..:|..:..|
Human   226 LELSALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAK 290

  Fly   279 NKP--------LMVSQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVR 335
            .|.        |::|:..:...|:.|:|.|:|..|...|.:|:::.:.:.||.||::.:.|.|.|
Human   291 AKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCR 355

  Fly   336 KECQEVI-EKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKG 398
            :|.||:: ::...|:.::.:..|.:|...:.|:|||:..:|.::|.|.:|..:| |.   ||.||
Human   356 QEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGR---VIPKG 417

  Fly   399 MPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRF--GQMQARI 461
            :..||.....|.:..::.:|..::|..|.|:.:|||..:.::||..|||||||..|  .:|:..:
Human   418 IICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVL 482

  Fly   462 GLALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGIYLKAE 502
            ||.||    :|.|....|.|.  .|...::.:..|::|:.|
Human   483 GLTLL----RFRVLPDHTEPR--RKPELVLRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 119/508 (23%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 123/526 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.