DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4ad1

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster


Alignment Length:505 Identity:104/505 - (20%)
Similarity:206/505 - (40%) Gaps:84/505 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSM--KGVRTARSFNEIWTSYYNKFRG 68
            ::|..:|...|..:..:...|....:: ||...|:..:|::  .|::.|....:: ..|..|:  
  Fly     8 IILATILVFKGVRIFNYIDHMAGIMEM-IPGPTPYPFVGNLFQFGLKPAEYPKKV-LQYCRKY-- 68

  Fly    69 SGPFAGFYWFRRPAVFV-----------LETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQLFL 122
              .|.||    |..||:           ::..|:...|:.:.:.::    |..|.   |...|..
  Fly    69 --DFQGF----RSLVFLQYHMMLSDPAEIQNILSSSSLLYKEHLYS----FLRPW---LGDGLLT 120

  Fly   123 LDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFT---DVFGQNVAKSPVVEVRELLARFTTD 184
            ..|.:|...:...:..|....::.....|.:...:|.   ||....   ..|.:.:||:|:.|.|
  Fly   121 SSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDT---QEVFDAQELVAKCTLD 182

  Fly   185 VIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHMKMTAEPIERF- 248
            ::...|.|.:.|||....::..                 |.:....::.:    :.|...::|| 
  Fly   183 IVCENATGQDSSSLNGETSDLH-----------------GAIKDLCDVVQ----ERTFSIVKRFD 226

  Fly   249 -FMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVS---QSGESVN----------------L 293
             ..|:....:..|...::.|:: ::::|..:...|...   |.|:.:|                |
  Fly   227 ALFRLTSYYMKQRRALSLLRSE-LNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVL 290

  Fly   294 TIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVI-EKCNGELNYESMKDL 357
            ...||..:...|...|.:..:..:.|.||.|:::.:||.:..:|.:.:. |...||.:...:..:
  Fly   291 KEREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQM 355

  Fly   358 VYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFN 422
            .||:.::.||||||..:|::.|......::.|..   :.|...|::...||..:||.:.:|.||.
  Fly   356 HYLELIIRETLRLYPSVPLIARTNRNPIDINGTK---VAKCTTVIMCLIAMGYNEKYFDDPCTFR 417

  Fly   423 PDNF-SPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFK 471
            |:.| :|......::.:.:||..|||.||..:|...|.:..|:.|::.|:
  Fly   418 PERFENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 99/476 (21%)
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 99/476 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.