DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:402 Identity:99/402 - (24%)
Similarity:190/402 - (47%) Gaps:48/402 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 FLLDG------QKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLA 179
            ||.||      |||.|.|..|:..|....::.......:.:.:|..:..:||...  :|:.:::.
  Fly   126 FLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFE--LELNQIIP 188

  Fly   180 RFTTDVIGTCAFGIECSSLKDPDAEFREM--GRRSLTEQRL-GPVG--------IGFVNSFPNLA 233
            :||.:.|...|.|::...:.:.: |:|:.  ....:..||: .|:.        .|....:..:.
  Fly   189 QFTLNNICETALGVKLDDMSEGN-EYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRIL 252

  Fly   234 RRLHMKMTAEPIERFFMRIV-RETVAFREQNNIRRNDF-MDQLIDLKNKPLMVSQSGESVNLTIE 296
            |.:|         .|...|: |:...|:::...:.::| ..|...:.:..|.....|:   :..:
  Fly   253 RTIH---------GFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEGK---IDHQ 305

  Fly   297 EIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLD 361
            .|..:...|...|::|:||::.|.|..||.:.|:|.|..:|.|::.|..: |::.....:|::|:
  Fly   306 GICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDID-EVSMFQFNELIHLE 369

  Fly   362 QVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNF 426
            .|:.|:|||:...|::.|.|:|:..:.|   .|:.|...:.|....:.||.:.:..||.|.|:.|
  Fly   370 CVIKESLRLFPSAPIIGRTCIEESVMNG---LVLPKNAQISIHIYDIMRDARHFPKPNQFLPERF 431

  Fly   427 SPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLI 491
            .||....|....::||..|||||||.:||.::.::.||.:|::||.       :|.|..::   :
  Fly   432 LPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKL-------LPATQLED---L 486

  Fly   492 ASNSGIYLKAER 503
            ...:||.|:.::
  Fly   487 TFENGIVLRTQQ 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 98/396 (25%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 99/402 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.