DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp309a2

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster


Alignment Length:503 Identity:124/503 - (24%)
Similarity:226/503 - (44%) Gaps:74/503 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIW--TSYYNKFRG 68
            ::|..||.|..||.:.|..  ::|:..|:....|..|:|:..|:.|.:| |.::  ...|:|::|
  Fly    40 LILLHLLVLPIYLYLTWHH--KYWRKRGLVTARPLTLLGTYPGLLTRKS-NLVFDVQKIYDKYKG 101

  Fly    69 SGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTD---RGFFHNPEDDPLSG-QLFLLDGQKWR 129
            .....|.:..|:|.:.||:..||.::|:..|..:.|   ..:..:.:.|..:. ..|...||.||
  Fly   102 KHRAVGVFVTRQPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDKYARLNPFWASGQSWR 166

  Fly   130 TMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVA-KSPVVEVRELLARFTTDVIGTCAFGI 193
            .:|....:..:..:::..:....:.....|:...|.|| |:.::|.|:|..|:|..|:....:||
  Fly   167 RLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILETRDLCFRYTAHVMADFIWGI 231

  Fly   194 ECSSLKDP---DAEFREMGRR-------SLTEQRLGPVGIGFVNSFPNLARRLHMKMTAEPIE-- 246
            :..:|..|   ..:.:||..:       .||.         |:.:......||.::....|.|  
  Fly   232 DAGTLTRPMEQPNKVQEMASKWTSYAFYMLTL---------FMATIVAPCSRLLLRFRFYPKETD 287

  Fly   247 RFFMRIVRETVAFR-EQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGF 310
            .||..:.:|::..| :..:..|.|::..|:.|:::.          ..|.:::...|......|:
  Fly   288 EFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQK----------QATHDDLVGHALTVMLDGY 342

  Fly   311 ETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKC---NGELNYESMKDLVYLDQVVSETLRLYT 372
            :||.|.:..|||.||:|..:|.::|.|    |..|   ...|::|.:..|.||:||:.|:|||.:
  Fly   343 DTSGTALLHALYYLAENPAVQQKLRVE----ILSCMASEKSLDFEKLSSLQYLEQVIYESLRLSS 403

  Fly   373 VLPVLNRECL------------EDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDN 425
            ::|...:.|.            .|.||          ||.::||....|.|::.:..|..|.|:.
  Fly   404 LIPQYTKVCTLPTVIRLSESKSLDVEV----------GMTIMIPNYQFHHDKQYFPEPEAFKPER 458

  Fly   426 FSPERVKE--RDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFK 471
            |.....:|  |..: :|||.||||.|:|:....:..:..|..::.:|:
  Fly   459 FDNGAYQELMRKGI-FLPFSDGPRICMGVPLAMLTLKSALVHILSNFQ 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 115/474 (24%)
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 115/471 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460991
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.