DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:523 Identity:124/523 - (23%)
Similarity:209/523 - (39%) Gaps:129/523 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LALVGYLLMKWRSTMRH---------WQDLGIPCEEPHI--LMGSMKGVRTARSFNEIWTSYYNK 65
            ||||.::|  |.:.:|:         .|........|.|  |:.::|.........|:...:...
  Fly     4 LALVAFVL--WAAFLRYLPKILNFLRLQRFAKTLPGPTIGELIANVKKGEILNWLKELREKHGPV 66

  Fly    66 FRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPED----------------- 113
            ||        .||            .|.:::    .|||      |||                 
  Fly    67 FR--------IWF------------GKDLMV----MFTD------PEDIKQLLGNNQLLTKSRNY 101

  Fly   114 ---DPLSGQLFLLD-GQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNV-------- 166
               :|..|:..|.: |:.|...|..|:..|.           .::.:||.:...:|.        
  Fly   102 ELLEPWLGKGLLTNGGESWHRRRKLLTPGFH-----------FRILSEFKEPMEENCRILVRRLR 155

  Fly   167 --AKSPVVEVRELLARFTTDVIGTCAFGIECSSLKDPDAEF--------REMGRRSLT-EQRLGP 220
              |.....::...:..|..|.|...|.||:..:....|:|:        |.|.::|.: .|||  
  Fly   156 TKANGESFDIYPYITLFALDAICETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRL-- 218

  Fly   221 VGIGFVNSFPNLARRLHMKMTAEPIERFFMRIVRETVAFR--------EQNNI---RRNDFMDQL 274
             .:.|.::.|...|...:|:..:...| .:|:.||.:...        ||:::   ||..|:|. 
  Fly   219 -NVFFKHTKPGKEREAALKVLHDETNR-VIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDM- 280

  Fly   275 IDLKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQ 339
                   |:::|......|:..:|..:...|...|.:|:|:.:.|||..|::|.|:|.|..:|. 
  Fly   281 -------LLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEA- 337

  Fly   340 EVIEKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIP 404
                   .||.....:.:.||:.|:.||||:|..:|..:|:.|||.||   .|..:.||..:...
  Fly   338 -------SELEGREKESMPYLEAVIKETLRIYPSVPFFSRKVLEDLEV---GKLTVPKGASISCL 392

  Fly   405 CGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKD 469
            ...:|||.|.:.:|..|:||.|.... |:.....:..|..|||||||.:|..::.:..||:|::.
  Fly   393 IYMLHRDPKNFPDPERFDPDRFLVNE-KQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRS 456

  Fly   470 FKF 472
            ::|
  Fly   457 YRF 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 116/491 (24%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 116/490 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.