DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and cyp3c1

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_997838.1 Gene:cyp3c1 / 324340 ZFINID:ZDB-GENE-030131-3060 Length:505 Species:Danio rerio


Alignment Length:504 Identity:141/504 - (27%)
Similarity:252/504 - (50%) Gaps:59/504 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGS----MKG-----VRTARSFNEIWTS 61
            ||:..||.:.|.    |....  ::.||||...|...:|:    .||     :..::.:.::|  
Zfish    15 VLVITLLLIYGV----WPHGF--FKKLGIPGPRPLPFVGTALSYSKGICNFDIECSKKYGKVW-- 71

  Fly    62 YYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKE-FNKFTDRGFFHNPEDD---PLSGQLFL 122
                        |.|..|.|.:.|.:..:.|.||:|: ::.||:|   .|...|   |.:..:.|
Zfish    72 ------------GIYDGRLPLLLVTDLEMIKTILVKDCYSTFTNR---RNMNPDLVGPFADGITL 121

  Fly   123 LDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSP---VVEVRELLARFTTD 184
            :..::||.:|:.||..||||::|.:||    :|....|.|.:|:.|..   .:::::::|.::.|
Zfish   122 VKDERWRRIRSSLSPYFTSGRLKEIFP----IAMTHADRFIKNMEKKDPNLPLKIKDVVAPYSLD 182

  Fly   185 VIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVG--IGFVNSFPNLARRLHMKMTAEPIER 247
            |:.:.:|.::..|:.:||..|....:.......|.|:.  :.|..|..||..::.:.:.:.....
Zfish   183 VVASSSFSVDFDSINNPDDPFVTSIKSFFNINPLSPLFLLLAFCPSAANLLAKMGISVFSRSTTD 247

  Fly   248 FFMRIVRETVAFREQNNIRRNDFMDQLI--DLKNKPLMVSQSGESV-NLTIEEIAAQAFVFFAAG 309
            |:.:.:|:......::| .|.||:..:|  .:.:..:..:.|.:.| .||..||.:|:|:|...|
Zfish   248 FYYKALRKIKDEHNESN-GRVDFLKLMIQNQIPDDQVKDTASEQPVKGLTDHEILSQSFIFILGG 311

  Fly   310 FETSSTTMGFALYELAQNQDIQNRVRKECQEVIEK---CNGELNYESMKDLVYLDQVVSETLRLY 371
            :||:|||:.:.||.||.|.|...::.:|    |:|   .:..:.|:::..:.||:..:.|::|::
Zfish   312 YETTSTTLSYLLYNLATNPDCLEKLVEE----IDKNFPLDIPITYDALMRMDYLEMAIHESMRVF 372

  Fly   372 TVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDS 436
            ...|.|.|.|.:..|:.|   ..|.|...|.||...:.||..|:.:||.|.|:.||||...|.:.
Zfish   373 PAGPRLERVCKKTVEING---ITIPKNTLVGIPLYVLSRDPDLWESPNEFKPERFSPESKTEINQ 434

  Fly   437 VEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYN 485
            ..::|||.||||||||||..|..::.:..|::.:....|::|.||:..|
Zfish   435 CAFMPFGLGPRNCIGMRFALMMMKLLVVKLLQKYTVETCKETQIPVQLN 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 132/475 (28%)
cyp3c1NP_997838.1 p450 38..496 CDD:278495 132/475 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 226 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm8421
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.