DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4d1

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster


Alignment Length:466 Identity:104/466 - (22%)
Similarity:181/466 - (38%) Gaps:116/466 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KFTDRGFFHNPEDDPLSGQLFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQN 165
            :|.|:...:...:..|...|.:..|:||...|..::..|.           .|:.::|.:||.:.
  Fly   100 RFNDKAGEYKALEPWLKEGLLVSRGRKWHKRRKIITPAFH-----------FKILDQFVEVFEKG 153

  Fly   166 VAKSPVVEVRELLARF---------------------TTDVIGTCAFGIECSSLKDPDAEFREMG 209
                    .|:||...                     |.|.|...|.|:..::..:.|:|:    
  Fly   154 --------SRDLLRNMEQDRLKHGDSGFSLYDWINLCTMDTICETAMGVSINAQSNADSEY---- 206

  Fly   210 RRSLTEQRLGPVGIGFVNSFPNLARRLHMKMTAEPIERFFMRIVRETVAFREQNNIRR------- 267
                 .|.:..:.:.......|:..|..:.....|:.|...:.:.....|.|:..::|       
  Fly   207 -----VQAVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNVLHQFTEKIIVQRREELIRE 266

  Fly   268 -------ND-----------FMDQLID--LKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGFET 312
                   ||           |:|.|:.  :..:||.        ||.|.|   :...|...|.:|
  Fly   267 GSSQESSNDDADVGAKRKMAFLDILLQSTVDERPLS--------NLDIRE---EVDTFMFEGHDT 320

  Fly   313 SSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGE-----LNYESMKDLVYLDQVVSETLRLYT 372
            :|:.:.|..|.:|.:.:.|    |:|.|.|....|.     ::||.:..|.|:|..|.||||:|.
  Fly   321 TSSALMFFFYNIATHPEAQ----KKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYP 381

  Fly   373 VLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGA--------MHRDEKLYANPNTFNPDNFSPE 429
            .:|:|.|:.|||.|:.|.           |||.|.        :.|.|:|::.||.|.|:.|...
  Fly   382 SVPLLGRKVLEDCEINGK-----------LIPAGTNIGISPLYLGRREELFSEPNIFKPERFDVV 435

  Fly   430 RVKER-DSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLIAS 493
            ...|: :...::||..|||||||.:|..::.:..:|.:::.::......::.|.....|:.|...
  Fly   436 TTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTK 500

  Fly   494 NSGIYLKAERV 504
            ...::...|||
  Fly   501 EPLMFKVRERV 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 101/459 (22%)
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 101/460 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.