DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_006241152.1 Gene:Cyp4f39 / 299566 RGDID:1308796 Length:550 Species:Rattus norvegicus


Alignment Length:537 Identity:125/537 - (23%)
Similarity:239/537 - (44%) Gaps:74/537 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLTALLALVGYLLMK-WRSTMRHWQDLGIPCE------EP---HILMGSM-------KGVRTARS 54
            :|:|||..:.:||.: .....:.:.|..|.|.      ||   |.|:|.|       ||::..:.
  Rat    23 VLSALLLFLLFLLFRLLLQAFKLFSDFRITCRRLSCFPEPPGRHWLLGHMSMYLPNEKGLQNEKK 87

  Fly    55 FNEIWTSYYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQ 119
            ..:  |.::......|||.       |.:.::.....|.:|...........||::.....|...
  Rat    88 VLD--TMHHIILAWVGPFL-------PLLVLVHPDYIKPVLGASAAIAPKDEFFYSFLKPWLGDG 143

  Fly   120 LFLLDGQKWRTMRNKLSSTFTSGKMK-YMFPTVVKVANEFTDV----FGQNVAKSPVV--EVREL 177
            |.:..|.||...|..|:..|....:| ||     |:.|:..::    :.:::|:..|.  ::.|.
  Rat   144 LLISKGNKWSRHRRLLTPAFHFDILKPYM-----KIFNQSVNIMHAKWRRHLAEGSVTSFDMFEH 203

  Fly   178 LARFTTDVIGTCAFGI--EC-SSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHMK 239
            ::..|.|.:..|.|..  :| ..|.|..:...|:....:..|......:.|:.......||  .:
  Rat   204 VSLMTLDSLQKCVFSYSSDCQEKLSDYISSIIELSALVVRRQYRLHHYLDFIYYLTADGRR--FR 266

  Fly   240 MTAEPIERFFMRIVRE---------TVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTI 295
            ...:.:..|...::::         ..|:.:....:..||:|.|:..|::        |...|:.
  Rat   267 QACDTVHNFTTEVIQQRRRALRELGAEAWLKAKQGKTLDFIDVLLLAKDE--------EGKELSD 323

  Fly   296 EEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNG----ELNYESMKD 356
            |:|.|:|..|...|.:|:|:.:.:||:.||:..:.|::.|:|.|||::   |    ||:::.:..
  Rat   324 EDIRAEADTFMFEGHDTTSSGLSWALFNLAKYPEYQDKCREEIQEVMK---GRELEELDWDDLTQ 385

  Fly   357 LVYLDQVVSETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMPVLIPCGAMHRDEKLYANPNT 420
            |.:....:.|:||.:..:.:::|.|.||.::| |.   :|.||:..|:.....|.:..::.:...
  Rat   386 LPFTTMCIKESLRQFPPVTLISRRCTEDIKLPDGR---IIPKGIICLVSIYGTHYNPLVWPDSKV 447

  Fly   421 FNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYN 485
            :||..|.|:..::|..:.::||..|||||||..|...:.|:.:||.:..|:.|| ::|.  ....
  Rat   448 YNPYRFDPDIPQQRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRLSV-DRTR--KVRR 509

  Fly   486 KEMFLIASNSGIYLKAE 502
            |...::.:.:|::|..|
  Rat   510 KPELILRTENGLWLNVE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 115/503 (23%)
Cyp4f39XP_006241152.1 CYP4F 82..523 CDD:410772 106/473 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.