DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:540 Identity:127/540 - (23%)
Similarity:223/540 - (41%) Gaps:89/540 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTVLLTALLALVG----YLLMKW--------RSTMRHWQDLGIPCEEPHILMG-SMKGVRTARSF 55
            |..||:..|.|..    ||..:|        .||..||            |.| .:|.    |.|
  Rat    21 GAFLLSLFLVLFKAVQFYLRRQWLLKALEKFPSTPSHW------------LWGHDLKD----REF 69

  Fly    56 NEIWTSYYNKFRGSGPFAGFYWF--RRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSG 118
            .::.| :..||    |.|...|.  .:..|.:.:....|.:|.:...|.:  |.:.......:||
  Rat    70 QQVLT-WVEKF----PGACLQWLSGSKTRVLLYDPDYVKVVLGRSDPKAS--GIYQFLAPWIVSG 127

  Fly   119 Q---LFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLAR 180
            .   |.||:|:||......|:..|..|.:|.....:....:...|.:.:...:...:|:...::.
  Rat   128 TGYGLLLLNGKKWFQHWRMLTPAFHYGILKPYVKIMADSVSIMLDKWEKLDDQDHPLEIFHYVSL 192

  Fly   181 FTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGF--------VNSFPNLARRL- 236
            .|.|.:..|||..:.|...|.::.........|.......|...|        ::|...|:||. 
  Rat   193 MTLDTVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLTFFRVRSAFYGNSIIYNMSSDGRLSRRAC 257

  Fly   237 -----H----MKMTAEPIERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVN 292
                 |    :||....::.     ..|....|::.::   ||:|.|:..|      .:.|:|  
  Rat   258 QIAHEHTDGVIKMRKAQLQN-----EEELQKARKKRHL---DFLDILLFAK------MEDGKS-- 306

  Fly   293 LTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGE---LNYESM 354
            |:.|::.|:...|...|.:|:::.:.:..|.||.:.:.|.|.|:|.|.::    |:   :.::.:
  Rat   307 LSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQSIL----GDGTSVTWDHL 367

  Fly   355 KDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPN 419
            ..:.|....:.|.||||..:|.::||.......|....  |.||:...|....:|.:...:.||.
  Rat   368 DQISYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGRS--IPKGITTTILIYGLHHNPSYWPNPK 430

  Fly   420 TFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTY 484
            .|:|..|||:  ..|.|..:|||..|.|||||.:|...:.::.:||.:..|:. :.:.|.||:..
  Rat   431 VFDPSRFSPD--SPRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFEL-LPDPTRIPVPM 492

  Fly   485 NKEMFLIASNSGIYLKAERV 504
            .:  .::.|.:||:|:.:::
  Rat   493 AR--LVLKSKNGIHLRLKKL 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 114/490 (23%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 110/470 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.