DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4f5

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_775147.1 Gene:Cyp4f5 / 286905 RGDID:708364 Length:526 Species:Rattus norvegicus


Alignment Length:406 Identity:99/406 - (24%)
Similarity:184/406 - (45%) Gaps:37/406 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LSGQLFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQN-----VAKSPVVEVR 175
            |...|||..|.||...|..|:..|....:|    ..||:.|:..::....     :..|..:|:.
  Rat   132 LGDGLFLSSGDKWSRHRRLLTPAFHFDILK----PYVKIFNQSVNIMHAKWKHLCLEGSARLEMF 192

  Fly   176 ELLARFTTDVIGTCAFGIECSSLKDPD---AEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLH 237
            |.::..|.|.:..|.||.:.:..:.|.   :...|:.  ||..:|...:.:.....:...|....
  Rat   193 ENISLMTLDSLQKCLFGFDSNCQESPSEYISAILELS--SLIIKRSQQLFLYLDFLYYRTADGRR 255

  Fly   238 MKMTAEPIERFFMRIVRE---------TVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNL 293
            .:...:.:..|...::||         |..|.|.....::..:| .||:    |::::......|
  Rat   256 FRKACDLVHNFTDAVIRERRRLLSSQGTDEFLESKTKSKSKTLD-FIDV----LLLAKDEHGKEL 315

  Fly   294 TIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVI-EKCNGELNYESMKDL 357
            :.|:|.|:|..|...|.:|:::.:.:.||.||::.:.|.|.|:|..|:: ::...|:.::.:..|
  Rat   316 SDEDIRAEADTFMFGGHDTTASALSWILYNLARHPEYQERCRQEVWELLRDREPEEIEWDDLAQL 380

  Fly   358 VYLDQVVSETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTF 421
            .:|...:.|:|||:.....|.|.|.:|..:| |.   ||.||...:|....:|.:..::.:|..|
  Rat   381 PFLTMCIKESLRLHPPAIDLLRRCTQDIVLPDGR---VIPKGNICVISIFGIHHNPSVWPDPEVF 442

  Fly   422 NPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNK 486
            :|..|..|..::|..:.::||..|||||||..|...:.::.:||.:  .:|.|......|.  .|
  Rat   443 DPFRFDSENRQKRSPLSFIPFSAGPRNCIGQTFAMNEMKVVVALTL--LRFRVLPDDKEPR--RK 503

  Fly   487 EMFLIASNSGIYLKAE 502
            ...::.:..|::|:.|
  Rat   504 PEIILRAEGGLWLRME 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 97/401 (24%)
Cyp4f5NP_775147.1 p450 52..516 CDD:278495 97/401 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.