DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP4V2

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_997235.3 Gene:CYP4V2 / 285440 HGNCID:23198 Length:525 Species:Homo sapiens


Alignment Length:557 Identity:138/557 - (24%)
Similarity:221/557 - (39%) Gaps:115/557 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVLLTALLALVGYLLMKWRSTMRHWQDL-GIPCEE------PHILMGSMKGVRTARSFNEIWTSY 62
            :.|..|..:||..||.:..|..|.||.: .||...      .|.|:....|    |.|.:....|
Human    20 SALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDG----REFFQQIIEY 80

  Fly    63 YNKFR---------GSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSG 118
            ..::|         |..|....|  ....|.|:.|| :|||......||.          :|..|
Human    81 TEEYRHMPLLKLWVGPVPMVALY--NAENVEVILTS-SKQIDKSSMYKFL----------EPWLG 132

  Fly   119 -QLFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFT 182
             .|....|.|||:.|..|:.||.           ..:..:|.|:..:...    :.|::|.....
Human   133 LGLLTSTGNKWRSRRKMLTPTFH-----------FTILEDFLDIMNEQAN----ILVKKLEKHIN 182

  Fly   183 TDV------IGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLA----RRLH 237
            .:.      |..||..|.|.:     |..:.:|.:|..:..       :|.:...::    ||:.
Human   183 QEAFNCFFYITLCALDIICET-----AMGKNIGAQSNDDSE-------YVRAVYRMSEMIFRRIK 235

  Fly   238 M------------------KMTAEPIERFFMRIVRETVAFREQNNIRRND-------------FM 271
            |                  |.:.:.:..|...::.|.......|...|.|             |:
Human   236 MPWLWLDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFL 300

  Fly   272 DQLIDLKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRK 336
            |.|:.:.:        .|...|:.|:|..:...|...|.:|::..:.::||.|..|.::|.:|..
Human   301 DLLLSVTD--------DEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDH 357

  Fly   337 ECQEVIEKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPV 401
            |..:|..|.:.....|.:|.|.||:.|:.|||||:..:|:..|...||.||.|   |.:.||...
Human   358 ELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAG---YRVLKGTEA 419

  Fly   402 LIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALL 466
            :|...|:|||.:.:.||..|.|:.|.||..:.|....::||..|||||||.:|..|:.:..|:.:
Human   420 VIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCI 484

  Fly   467 IKDFKFSVCEKTTIPMTYNKEMFLIASNSGIYLKAER 503
            ::.|.....:|.. .:....::.|..|| ||::|.:|
Human   485 LRHFWIESNQKRE-ELGLEGQLILRPSN-GIWIKLKR 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 125/520 (24%)
CYP4V2NP_997235.3 p450 55..517 CDD:278495 124/518 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.