DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP4A22

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:529 Identity:127/529 - (24%)
Similarity:226/529 - (42%) Gaps:64/529 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTVLLTALLALVGYLLMKWRSTMRHWQDL-----GIPCEEPHILMGSMKGVRTARSFNEIWTSYY 63
            |.:.:|:||.|: .||:|......|.|.|     ..||...|.|.|.::..:..:....| ....
Human    17 GILQVTSLLILL-LLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRI-QERV 79

  Fly    64 NKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQKW 128
            ..|..:.|:  :.|..:..|.:.:....|.||.:...|......|..|.   :...|.||:||.|
Human    80 KTFPSACPY--WIWGGKVRVQLYDPDYMKVILGRSDPKSHGSYKFLAPR---IGYGLLLLNGQTW 139

  Fly   129 RTMRNKLSSTFTSGKMK----YMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGTC 189
            ...|..|:..|.:..:|    .|..:|..:.:::.::.||:   || :||.:.::..|.|.|...
Human   140 FQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQD---SP-LEVFQHVSLMTLDTIMKS 200

  Fly   190 AFGIECSSLKDPDAE----------------FREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHM 238
            ||..:.|...|.:::                .|.....:.|...|...|     .:.:.|.:|..
Human   201 AFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAG-----RWTHRACQLAH 260

  Fly   239 KMTAEPIERFFMRIVRETVAFREQNNIRRN---DFMDQLIDLKNKPLMVSQSGESVNLTIEEIAA 300
            :.|.:.|:....::.:|    .|...|:|.   ||:|.|       |:......|: |:.:::.|
Human   261 QHTDQVIQLRKAQLQKE----GELEKIKRKRHLDFLDIL-------LLAKMENGSI-LSDKDLRA 313

  Fly   301 QAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVS 365
            :...|...|.:|:::.:.:.||.||.:...|.|.|:|...::.. ...:.:..:..:.|....:.
Human   314 EVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGD-GASITWNHLDQMPYTTMCIK 377

  Fly   366 ETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPER 430
            |.||||..:|.:.||.......|....  :.||:.||:....:|.:.|::.|...|:|..|:|..
Human   378 EALRLYPPVPGIGRELSTPVTFPDGRS--LPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFAPGS 440

  Fly   431 VKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLIASNS 495
            .:.  |..:|||..|.|||||.:|...|.::..||.:..|:. :.:.|.||:...:  .::.|.:
Human   441 AQH--SHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFEL-LPDPTRIPIPMAR--LVLKSKN 500

  Fly   496 GIYLKAERV 504
            ||:|:..|:
Human   501 GIHLRLRRL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 114/486 (23%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 114/487 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.