DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4a12a

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_803125.2 Gene:Cyp4a12a / 277753 MGIID:88612 Length:508 Species:Mus musculus


Alignment Length:536 Identity:127/536 - (23%)
Similarity:220/536 - (41%) Gaps:84/536 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVGTVLLTALLALVGYLLMKW--RSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYYN 64
            ||.::||........||..:|  .||.:      .|....|.|.|..  :...:...:|.|...|
Mouse    23 SVLSLLLLLFKTAQLYLHRQWLLSSTQQ------FPSPPSHWLFGHK--ILKDQDLQDILTRIKN 79

  Fly    65 KFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQKWR 129
             |..:.|  .:.|..:..:.|.:....|.||.:...|......|..|.   :...|.:||||.|.
Mouse    80 -FPSACP--QWLWGSKVRIQVYDPDYMKLILGRSDPKANGSYRFLAPW---IGRGLLMLDGQTWF 138

  Fly   130 TMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGTCAFGIE 194
            ..|..|:..|....:|.....:........|.:.|.|.:...:|:...:...|.|.|..|||..|
Mouse   139 QHRRMLTPAFHYDILKPYTEIMADSVRVMLDKWEQIVGQDSTLEIFRHITLMTLDTIMKCAFSHE 203

  Fly   195 CSSLKD-------------PDAEFREMGRRSLTEQ-----RLGPVGIGFVNSFPNLA-------- 233
            .|...|             .|..|..:  |::..|     |:...|.. .||...||        
Mouse   204 GSVQLDRKYKSYIQAVEDLNDLVFSRV--RNIFHQNDIIYRVSSNGCK-ANSACKLAHDHTDQVI 265

  Fly   234 --RRLHMKMTAEPIERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIE 296
              ||:.:: ..|.:|:...:              ||.||:|.|:..:      .::|:|  |:.:
Mouse   266 KSRRIQLQ-DEEELEKLKKK--------------RRLDFLDILLFAR------MENGKS--LSDK 307

  Fly   297 EIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGE---LNYESMKDLV 358
            ::.|:...|...|.:|:::.:.:..|.||.|.:.|.|.|||.|.::    |:   :.:..:..:.
Mouse   308 DLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLL----GDGTSITWNDLDKMP 368

  Fly   359 YLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNP 423
            |....:.|.||:|..:|.::||.......|....  :.||:.|::....:|.:..::.||..|:|
Mouse   369 YTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRS--LPKGIHVMLSFYGLHHNPTVWPNPEVFDP 431

  Fly   424 DNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEM 488
            ..|:|.  ..|.|..:|||..|.|||||.:|...:.::.:||.:..|:. :.:.|.:|:...:  
Mouse   432 SRFAPG--SSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFEL-LPDPTRVPIPIPR-- 491

  Fly   489 FLIASNSGIYLKAERV 504
            .::.|.:||:|..:::
Mouse   492 IVLKSKNGIHLHLKKL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 117/494 (24%)
Cyp4a12aNP_803125.2 p450 52..502 CDD:278495 117/494 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.